From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003282000
  • symbol?: purL
  • description?: phosphoribosylformylglycinamidine synthase II

      descriptions from strain specific annotations:

    • phosphoribosylformylglycinamidine synthase II
    • Phosphoribosylformylglycinamidine synthase, synthetase subunit
    • putative phosphoribosylformylglycinamidinesynthase II
    • phosphoribosylformylglycinamidine synthase 2
  • strand?: +
  • coordinates?: 3655701..3657890
  • synteny block?: BlockID0023660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1078 (purL)
    N315:
    SA0921 (purL)
    NCTC8325:
    Newman:
    NWMN_0937 (purL)
    USA300_FPR3757:
    04-02981:
    SA2981_1025 (purL)
    08BA02176:
    C248_1094 (purL)
    11819-97:
    MS7_1027 (purL)
    71193:
    ST398NM01_1067
    ECT-R 2:
    ECTR2_925 (purL)
    ED133:
    SAOV_1014
    ED98:
    SAAV_1034 (purL)
    HO 5096 0412:
    SAEMRSA15_09000 (purL)
    JH1:
    SaurJH1_1151
    JH9:
    SaurJH9_1129
    JKD6008:
    SAA6008_01025 (purL)
    JKD6159:
    SAA6159_00925 (purL)
    LGA251:
    SARLGA251_09830 (purL)
    M013:
    M013TW_1001
    MRSA252:
    SAR1043 (purL)
    MSHR1132:
    SAMSHR1132_09170
    MSSA476:
    SAS1005
    Mu3:
    SAHV_1061 (purL)
    Mu50:
    SAV1069 (purL)
    MW2:
    MW0952 (purL)
    RF122:
    SAB0936 (purL)
    ST398:
    SAPIG1067 (purL)
    T0131:
    SAT0131_01105
    TCH60:
    HMPREF0772_12164 (purL)
    TW20:
    SATW20_10650 (purL)
    USA300_TCH1516:
    USA300HOU_1014 (purL)
    VC40:
    SAVC_04510

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKFIEPSVEEIKLEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHS
    N315            MSKFIEPSVEEIKLEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHS
    NCTC8325        MSKFIEPSVEEIKLEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHS
    Newman          MSKFIEPSVEEIKLEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHS
    USA300_FPR3757  MSKFIEPSVEEIKLEKVYQDMGLSDQEYEKVCDILGRQPNFTETGIFSVMWSEHCSYKHS
                    ************************************************************

    COL             KPFLKQFPTSGDHVLMGPGEGAGVVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGII
    N315            KPFLKQFPTSGEHVLMGPGEGAGVVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGII
    NCTC8325        KPFLKQFPTSGDHVLMGPGEGAGVVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGII
    Newman          KPFLKQFPTSGDHVLMGPGEGAGVVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGII
    USA300_FPR3757  KPFLKQFPTSGDHVLMGPGEGAGVVDIGDNQAVVFKVESHNHPSAIEPYQGAATGVGGII
                    ***********:************************************************

    COL             RDIVSIGARPINLLNSLRFGELDNKQNQRLLKGVVKGIGGYGNCIGIPTTAGEIEFDERY
    N315            RDIVSIGARPINLLNSLRFGELDNKQNQRLLKGVVKGIGGYGNCIGIPTTAGEIEFDERY
    NCTC8325        RDIVSIGARPINLLNSLRFGELDNKQNQRLLKGVVKGIGGYGNCIGIPTTAGEIEFDERY
    Newman          RDIVSIGARPINLLNSLRFGELDNKQNQRLLKGVVKGIGGYGNCIGIPTTAGEIEFDERY
    USA300_FPR3757  RDIVSIGARPINLLNSLRFGELDNKQNQRLLKGVVKGIGGYGNCIGIPTTAGEIEFDERY
                    ************************************************************

    COL             DGNPLVNAMCVGVINHDMIQKGTAKGVGNSVIYVGLKTGRDGIHGATFASEELTEESESK
    N315            DGNPLVNAMCVGVINHDMIQKGTAKGVGNSVIYVGLKTGRDGIHGATFASEELTEESESK
    NCTC8325        DGNPLVNAMCVGVINHDMIQKGTAKGVGNSVIYVGLKTGRDGIHGATFASEELTEESESK
    Newman          DGNPLVNAMCVGVINHDMIQKGTAKGVGNSVIYVGLKTGRDGIHGATFASEELTEESESK
    USA300_FPR3757  DGNPLVNAMCVGVINHDMIQKGTAKGVGNSVIYVGLKTGRDGIHGATFASEELTEESESK
                    ************************************************************

    COL             RPSVQIGDPFVGKKLMEATLEAITFDELVGIQDMGAAGLTSSSSEMAAKGGSGLHLRLEQ
    N315            RPSVQIGDPFVGKKLMEATLEAITFDELVGIQDMGAAGLTSSSSEMAAKGGSGLHLRLEQ
    NCTC8325        RPSVQIGDPFVGKKLMEATLEAITFDELVGIQDMGAAGLTSSSSEMAAKGGSGLHLRLEQ
    Newman          RPSVQIGDPFVGKKLMEATLEAITFDELVGIQDMGAAGLTSSSSEMAAKGGSGLHLRLEQ
    USA300_FPR3757  RPSVQIGDPFVGKKLMEATLEAITFDELVGIQDMGAAGLTSSSSEMAAKGGSGLHLRLEQ
                    ************************************************************

    COL             VPTREPGISPYEMMLSETQERMLLVVEKGTEQKFLDLFDKHELDSAVIGEVTDTNRFVLT
    N315            VPTREPGISPYEMMLSETQERMLLVVEKGNEQKFLDLFDKHELDSAVIGEVTDTNRFVLT
    NCTC8325        VPTREPGISPYEMMLSETQERMLLVVEKGTEQKFLDLFDKHELDSAVIGEVTDTNRFVLT
    Newman          VPTREPGISPYEMMLSETQERMLLVVEKGTEQKFLDLFDKHELDSAVIGEVTDTNRFVLT
    USA300_FPR3757  VPTREPGISPYEMMLSETQERMLLVVEKGTEQKFLDLFDKHELDSAVIGEVTDTNRFVLT
                    *****************************.******************************

    COL             YDDEVYADIPVEPLADEAPVYILEGEEKDYNTSKNDYTHIDVKDTFFKLLKHPTIASKHY
    N315            YDDEVYADIPVEPLADEAPVYILEGEEKDYNTSKNDYTHIDVKDTFFKLLKHPTIASKHY
    NCTC8325        YDDEVYADIPVEPLADEAPVYILEGEEKDYNTSKNDYTHIDVKDTFFKLLKHPTIASKHY
    Newman          YDDEVYADIPVEPLADEAPVYILEGEEKDYNTSKNDYTHIDVKDTFFKLLKHPTIASKHY
    USA300_FPR3757  YDDEVYADIPVEPLADEAPVYILEGEEKDYNTSKNDYTHIDVKDTFFKLLKHPTIASKHY
                    ************************************************************

    COL             LYDQYDQQVGANTIIKPGLQASVVRVEGTNKAIASTIDGEARYVYNNPYEGGKMVVAEAY
    N315            LYDQYDQQVGANTIIKPGLQASVVRVEGTNKAIASTIDGEARYVYNNPYEGGKMVVAEAY
    NCTC8325        LYDQYDQQVGANTIIKPGLQASVVRVEGTNKAIASTIDGEARYVYNNPYEGGKMVVAEAY
    Newman          LYDQYDQQVGANTIIKPGLQASVVRVEGTNKAIASTIDGEARYVYNNPYEGGKMVVAEAY
    USA300_FPR3757  LYDQYDQQVGANTIIKPGLQASVVRVEGTNKAIASTIDGEARYVYNNPYEGGKMVVAEAY
                    ************************************************************

    COL             RNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDSTKGMAEACDILKTPVVSGNVSLYNET
    N315            RNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDSTKGMAEACDILKTPVVSGNVSLYNET
    NCTC8325        RNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDSTKGMAEACDILKTPVVSGNVSLYNET
    Newman          RNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDSTKGMAEACDILKTPVVSGNVSLYNET
    USA300_FPR3757  RNLIAVGATPLAMTDCLNYGSPEKKEIYQQLIDSTKGMAEACDILKTPVVSGNVSLYNET
                    ************************************************************

    COL             KGTSIFPTPVVGMVGLIENVNYLNDFEPQVGDKLYLIGDTKDDFGGSQLEKLIYGKVNHE
    N315            KGTSIFPTPVVGMVGLIENVNYLNDFEPQVGDKLYLIGDTKDDFGGSQLEKLIYGKVNHE
    NCTC8325        KGTSIFPTPVVGMVGLIENVNYLNDFEPQVGDKLYLIGDTKDDFGGSQLEKLIYGKVNHE
    Newman          KGTSIFPTPVVGMVGLIENVNYLNDFEPQVGDKLYLIGDTKDDFGGSQLEKLIYGKVNHE
    USA300_FPR3757  KGTSIFPTPVVGMVGLIENVNYLNDFEPQVGDKLYLIGDTKDDFGGSQLEKLIYGKVNHE
                    ************************************************************

    COL             FESLDLSSEVEKGESIKTAIREGLLSHVQTVGKGGLLITLAKLSAHYGLGLKSSIDITNA
    N315            FESLDLSSEVEKGESIKTAIREGLLSHVQTVGKGGLLITLAKLSAHYGLGLKSSIDITNA
    NCTC8325        FESLDLSSEVEKGESIKTAIREGLLSHVQTVGKGGLLITLAKLSAHYGLGLKSSIDITNA
    Newman          FESLDLSSEVEKGESIKTAIREGLLSHVQTVGKGGLLITLAKLSAHYGLGLKSSIDITNA
    USA300_FPR3757  FESLDLSSEVEKGESIKTAIREGLLSHVQTVGKGGLLITLAKLSAHYGLGLKSSIDITNA
                    ************************************************************

    COL             QLFSETQGRYVVSVKSGKTLNIDNAIEIGLLTDSDNFKVTTPYTEISENVSDIKQIWEGA
    N315            QLFSETQGRYVVSVKSGKTLNIDNAIEIGLLTDSDNFKVTTPYTEISENVSDIKQIWEGA
    NCTC8325        QLFSETQGRYVVSVKSGKTLNIDNAIEIGLLTDSDNFKVTTPYTEISENVSDIKQIWEGA
    Newman          QLFSETQGRYVVSVKSGKTLNIDNAIEIGLLTDSDNFKVTTPYTEISENVSDIKQIWEGA
    USA300_FPR3757  QLFSETQGRYVVSVKSGKTLNIDNAIEIGLLTDSDNFKVTTPYTEISENVSDIKQIWEGA
                    ************************************************************

    COL             IAQCLTTQD
    N315            IAQCLTTQD
    NCTC8325        IAQCLTTQD
    Newman          IAQCLTTQD
    USA300_FPR3757  IAQCLTTQD
                    *********