From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003286000
  • symbol?: purH
  • description?: bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase

      descriptions from strain specific annotations:

    • bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
    • bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase
    • IMP cyclohydrolase / Phosphoribosylaminoimidazolecarboxamide formyltransferase
    • putative bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase
    • bifunctional purine biosynthesis protein PurH
    • bifunctional purine biosynthesis protein PurH [includes: phosphoribosylaminoimidazolecarboxamide formyltransferase
    • putative bifunctional purine biosynthesis phosphoribosylaminoimidazolecarboxamideformyltransferase/IMP cyclohydrolase
  • strand?: +
  • coordinates?: 3660949..3662436
  • synteny block?: BlockID0023700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1082 (purH)
    N315:
    SA0925 (purH)
    NCTC8325:
    Newman:
    NWMN_0941 (purH)
    USA300_FPR3757:
    04-02981:
    SA2981_1029 (purH)
    08BA02176:
    C248_1098 (purH)
    11819-97:
    MS7_1031 (purH)
    71193:
    ST398NM01_1071
    ECT-R 2:
    ECTR2_929 (purH)
    ED133:
    SAOV_1018
    ED98:
    SAAV_1038 (purH)
    HO 5096 0412:
    SAEMRSA15_09040 (purH)
    JH1:
    SaurJH1_1155 (purH)
    JH9:
    SaurJH9_1133 (purH)
    JKD6008:
    SAA6008_01029 (purH)
    JKD6159:
    SAA6159_00929 (purH)
    LGA251:
    SARLGA251_09870 (purH)
    M013:
    M013TW_1005
    MRSA252:
    SAR1047 (purH)
    MSHR1132:
    SAMSHR1132_09210
    MSSA476:
    SAS1009 (purH)
    Mu3:
    SAHV_1065 (purH)
    Mu50:
    SAV1073 (purH)
    MW2:
    MW0956 (purH)
    RF122:
    SAB0940 (purH)
    ST398:
    SAPIG1071 (purH)
    T0131:
    SAT0131_01109
    TCH60:
    HMPREF0772_12160 (purH)
    TW20:
    SATW20_10690 (purH)
    USA300_TCH1516:
    USA300HOU_1017 (purH)
    VC40:
    SAVC_04530 (purH)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MKKAILSVSNKTGIVEFAKALTQLNYELYSTGGTKRILDEANVPVRSVSDLTHFPEIMD
    N315            MMKKAILSVSNKTGIVEFAKALTQLNYELYSTGGTKRILDEANVPVRSVSDLTHFPEIMD
    NCTC8325        -MKKAILSVSNKTGIVEFAKALTQLNYELYSTGGTKRILDEANVPVRSVSDLTHFPEIMD
    Newman          -MKKAILSVSNKTGIVEFAKALTQLNYELYSTGGTKRILDEANVPVRSVSDLTHFPEIMD
    USA300_FPR3757  -MKKAILSVSNKTGIVEFAKALTQLNYELYSTGGTKRILDEANVPVRSVSDLTHFPEIMD
                     ***********************************************************

    COL             GRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNLYPFQQTVANPDVTMDEAI
    N315            GRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNLYPFQQTVANPDVTMDEAI
    NCTC8325        GRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNLYPFQQTVANPDVTMDEAI
    Newman          GRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNLYPFQQTVANPDVTMDEAI
    USA300_FPR3757  GRVKTLHPAVHGGILADRNKPQHLNELSEQHIDLIDMVVVNLYPFQQTVANPDVTMDEAI
                    ************************************************************

    COL             ENIDIGGPTMLRAAAKNYKHVTTIVHPADYQEVLTRLRNDSLDESYRQSLMIKVFEHTAE
    N315            ENIDIGGPTMLRAAAKNYKHVTTIVHPADYHEVLTRLRNDSLDESYRQSLMIKVFEHTAE
    NCTC8325        ENIDIGGPTMLRAAAKNYKHVTTIVHPADYQEVLTRLRNDSLDESYRQSLMIKVFEHTAE
    Newman          ENIDIGGPTMLRAAAKNYKHVTTIVHPADYQEVLTLLRNDSLDESYRQSLMIKVFEHTAE
    USA300_FPR3757  ENIDIGGPTMLRAAAKNYKHVTTIVHPADYQEVLTRLRNDSLDESYRQSLMIKVFEHTAE
                    ******************************:**** ************************

    COL             YDEAIVRFFKGDKETLRYGENPQQSAYFVRTSNAKHTIAGAKQLHGKQLSYNNIKDADAT
    N315            YDEAIVRFFKGDKETLRYGENPQQSAYFVRTSNAKHTIAGAKQLHGKQLSYNNIKDADAT
    NCTC8325        YDEAIVRFFKGDKETLRYGENPQQSAYFVRTSNAKHTIAGAKQLHGKQLSYNNIKDADAT
    Newman          YDEAIVRFFKGDKETLRYGENPQQSAYFVRTSNAKHTIAGAKQLHGKQLSYNNIKDADAT
    USA300_FPR3757  YDEAIVRFFKGDKETLRYGENPQQSAYFVRTSNAKHTIAGAKQLHGKQLSYNNIKDADAT
                    ************************************************************

    COL             LALVKKFDTPATVAVKHMNPCGVGIGDTIEQAFQHAYEADSQSIFGGIVALNRAVTPELA
    N315            LALVKKFDTPAAVAVKHMNPCGVGIGDTIEQAFQHAYEADSQSIFGGIVALNRAVTPELA
    NCTC8325        LALVKKFDTPATVAVKHMNPCGVGIGDTIEQAFQHAYEADSQSIFGGIVALNRAVTPELA
    Newman          LALVKKFDTPATVAVKHMNPCGVGIGDTIEQAFQHAYEADSQSIFGGIVALNRAVTPELA
    USA300_FPR3757  LALVKKFDTPATVAVKHMNPCGVGIGDTIEQAFQHAYEADSQSIFGGIVALNRAVTPELA
                    ***********:************************************************

    COL             EQLHSIFLEVIIAPKFTDEALDILKQKKNVRLLEIDMTIDSNEEEFVSVSGGYLVQDKDN
    N315            EQLHSIFLEVIIAPKFTDEALDILKQKKNVRLLEIDMTIDSNEEEFVSVSGGYLVQDKDN
    NCTC8325        EQLHSIFLEVIIAPKFTDEALDILKQKKNVRLLEIDMTIDSNEEEFVSVSGGYLVQDKDN
    Newman          EQLHSIFLEVIIAPKFTDEALDILKQKKNVRLLEIDMTIDSNEEEFVSVSGGYLVQDKDN
    USA300_FPR3757  EQLHSIFLEVIIAPKFTDEALDILKQKKNVRLLEIDMTIDSNEEEFVSVSGGYLVQDKDN
                    ************************************************************

    COL             YVVPKEEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVGA
    N315            YVVPKEEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVGA
    NCTC8325        YVVPKEEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVGA
    Newman          YVVPKEEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVGA
    USA300_FPR3757  YVVPKEEMKVVTEVAPTDEQWEAMLLGWKVVPSVKSNAIILSNNKQTVGIGAGQMNRVGA
                    ************************************************************

    COL             AKIALERAIEINDHVALVSDGFFPMGDTVELAAQHGIKAIIQPGGSIKDQDSIDMANKHG
    N315            AKIALERAIEINDHVALVSDGFFPMGDTVELAAQHGIKAIIQPGGSIKDQDSIDMANKHG
    NCTC8325        AKIALERAIEINDHVALVSDGFFPMGDTVELAAQHGIKAIIQPGGSIKDQDSIDMANKHG
    Newman          AKIALERAIEINDHVALVSDGFFPMGDTVELAAQHGIKAIIQPGGSIKDQDSIDMANKHG
    USA300_FPR3757  AKIALERAIEINDHVALVSDGFFPMGDTVELAAQHGIKAIIQPSGSIKDQDSIDMANKHG
                    *******************************************.****************

    COL             IAMVVTGTRHFKH
    N315            IAMVVTGTRHFKH
    NCTC8325        IAMVVTGTRHFKH
    Newman          IAMVVTGTRHFKH
    USA300_FPR3757  IAMVVTGTRHFKH
                    *************