From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003301000
  • symbol?:
  • description?: LSU m5C1962 methyltransferase RlmI

      descriptions from strain specific annotations:

    • LSU m5C1962 methyltransferase RlmI
    • SAM-dependent methyltransferase-like protein
    • putative SAM-dependent methyltransferase
    • S-adenosylmethionine-dependent methyltransferase family protein
    • SAM binding domain protein,PUA domain-containing protein
    • 50S m5C1962 methyltransferase RlmI
    • putative SAM-dependent methyltransferases
    • protein YwbD
    • Methyltransferase
  • strand?: +
  • coordinates?: 3671820..3672992
  • synteny block?: BlockID0023850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1037 (rlmI)
    08BA02176:
    C248_1107
    11819-97:
    MS7_1038
    71193:
    ST398NM01_1078
    ECT-R 2:
    ECTR2_936
    ED133:
    SAOV_1025
    ED98:
    SAAV_1046
    HO 5096 0412:
    SAEMRSA15_09110
    JH1:
    SaurJH1_1163
    JH9:
    SaurJH9_1141
    JKD6008:
    SAA6008_01036
    JKD6159:
    SAA6159_00937
    LGA251:
    SARLGA251_09940
    M013:
    M013TW_1013
    MRSA252:
    SAR1054
    MSHR1132:
    SAMSHR1132_09280
    MSSA476:
    SAS1016
    Mu3:
    SAHV_1073
    Mu50:
    SAV1081
    MW2:
    MW0963
    RF122:
    SAB0947
    ST398:
    SAPIG1078
    T0131:
    SAT0131_01117
    TCH60:
    HMPREF0772_12152 (ywbD)
    TW20:
    SATW20_10760
    USA300_TCH1516:
    USA300HOU_1023
    VC40:
    SAVC_04565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIATLNKGKETKYFNGYPLIEEEDIYSQDHLKEGDIFQIVTDKSQYVATAYVGRQHKGL
    N315            MKIATLNKGKETKYFNGYPLIEEEDIYSQDHLKEGDIFQIVTDKSQYVATAYVGRQHKGL
    NCTC8325        MKIATLNKGKETKYFNGYPLIEEEDIYSQDHLKEGDIFQIVTDKSQYVATAYVGRQHKGL
    Newman          MKIATLNKGKETKYFNGYPLIEEEDIYSQDHLKEGDIFQIVTDKSQYVATAYVGRQHKGL
    USA300_FPR3757  MKIATLNKGKETKYFNGYPLIEEEDIYSQDHLKEGDIFQIVTDKSQYVATAYVGRQHKGL
                    ************************************************************

    COL             GWVLTYDKAQQINTAFFVKLFNTALAERDYYFNIDGTNAFRLFNAEGDGVGGLTIDNYDG
    N315            GWVLTYDKAQEINTAFFVKLFNTALAERDYYFNIDGTNAFRLFNAEGDGVGGLTIDNYDG
    NCTC8325        GWVLTYDKAQQINTAFFVKLFNTALAERDYYFNIDGTNAFRLFNAEGDGVGGLTIDNYDG
    Newman          GWVLTYDKAQQINTAFFVKLFNTALAERDYYFNIDGTNAFRLFNAEGDGVGGLTIDNYDG
    USA300_FPR3757  GWVLTYDKAQQINTAFFVKLFNTALAERDYYFNIDGTNAFRLFNAEGDGVGGLTIDNYDG
                    **********:*************************************************

    COL             HLLIQWYSKGIYKFKYAILEAVRKVFDYKSIYEKVRFKDSEYSGGFVEGDAPEFPIVIEE
    N315            HLLIQWYSKGIYKFKYAILEAVRKVFDYKSIYEKVRFKDSEYSGGFVEGDAPEFPIVIEE
    NCTC8325        HLLIQWYSKGIYKFKYAILEAVRKVFDYKSIYEKVRFKDSEYSGGFVEGDAPEFPIVIEE
    Newman          HLLIQWYSKGIYKFKYAILEAVRKVFDYKSIYEKVRFKDSEYSGGFVEGDAPEFPIVIEE
    USA300_FPR3757  HLLIQWYSKGIYKFKYAILEAVRKVFDYKSIYEKVRFKDSEYSGGFVEGDAPEFPIVIEE
                    ************************************************************

    COL             NFTFYNVDLEDGLMTGIFLDQKEVRKKLRDQYAKERHVLNLFSYTGAFSAIAASEASSTT
    N315            NFTFYNVDLEDGLMTGIFLDQKEVRKKLRGQYAKERHVLNLFSYTGAFSVIAASEASSTT
    NCTC8325        NFTFYNVDLEDGLMTGIFLDQKEVRKKLRDQYAKERHVLNLFSYTGAFSAIAASEASSTT
    Newman          NFTFYNVDLEDGLMTGIFLDQKEVRKKLRDQYAKERHVLNLFSYTGAFSAIAASEASSTT
    USA300_FPR3757  NFTFYNVDLEDGLMTGIFLDQKEVRKKLRDQYAKERHVLNLFSYTGAFSAIAASEASSTT
                    *****************************.*******************.**********

    COL             SVDLANRSRSLTEENFGLNAIDPKSQYIYVMDTFDFYKYAARHGHSYDTIVIDPPSFARN
    N315            SVDLANRSRSLTEENFGLNAIDPKSQYIYVMDTFDFYKYAARHGHSYDTIVIDPPSFARN
    NCTC8325        SVDLANRSRSLTEENFGLNAIDPKSQYIYVMDTFDFYKYAARHGHSYDTIVIDPPSFARN
    Newman          SVDLANRSRSLTEENFGLNAIDPKSQYIYVMDTFDFYKYAARHGHSYDTIVIDPPSFARN
    USA300_FPR3757  SVDLANRSRSLTEENFGLNAIDPKSQYIYVMDTFDFYKYAARHGHSYDTIVIDPPSFARN
                    ************************************************************

    COL             KKRTFSVQKDYDKLINGALNILSSEGTLLLCTNASVYPLKQFKNTIKKTLEESGVDYELT
    N315            KKRTFSVQKDYDKLINGALNILSSEGTLLLCTNASVYPLKQFKNTIKKTLEESGVDYELT
    NCTC8325        KKRTFSVQKDYDKLINGALNILSSEGTLLLCTNASVYPLKQFKNTIKKTLEESGVDYELT
    Newman          KKRTFSVQKDYDKLINGALNILSSEGTLLLCTNASVYPLKQFKNTIKKTLEESGVDYELT
    USA300_FPR3757  KKRTFSVQKDYDKLINGALNILSSEGTLLLCTNASVYPLKQFKNTIKKTLEESGVDYELT
                    ************************************************************

    COL             EVMGLPKDFKTHPHYKPSKYLKAVFVNIRH
    N315            EVMGLPKDFKTHPHYKPSKYLKAVFVNIRH
    NCTC8325        EVMGLPKDFKTHPHYKPSKYLKAVFVNIRH
    Newman          EVMGLPKDFKTHPHYKPSKYLKAVFVNIRH
    USA300_FPR3757  EVMGLPKDFKTHPHYKPSKYLKAVFVNIRH
                    ******************************