From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003308000
  • symbol?: ktrA
  • description?: potassium transporter Trk

      descriptions from strain specific annotations:

    • potassium transporter Trk
    • TrkA potassium uptake family protein
    • potassium uptake protein
    • Trk system potassium uptake protein trkA
    • ktr system potassium uptake protein A
    • NAD+ binding potassium transporter
    • potassium transport protein
    • potassium uptake protein TrkA
    • pottasium uptake protein KtrA
    • putative potassium transport protein
    • trkA-C domain protein
    • TrkA domain-containing protein
    • TrkA-N domain-containing protein
    • Trk family K+ transporter NAD+ binding protein
    • Trk family potassium (K+) transporter, NAD+ binding protein
  • strand?: +
  • coordinates?: 3679132..3679794
  • synteny block?: BlockID0023920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1044 (trkA)
    08BA02176:
    C248_1114
    11819-97:
    MS7_1045 (ktrA)
    71193:
    ST398NM01_1085
    ECT-R 2:
    ECTR2_943
    ED133:
    SAOV_1032
    ED98:
    SAAV_1053
    HO 5096 0412:
    SAEMRSA15_09180
    JH1:
    SaurJH1_1170
    JH9:
    SaurJH9_1148
    JKD6008:
    SAA6008_01043 (trkA)
    JKD6159:
    SAA6159_00944 (trkA)
    LGA251:
    SARLGA251_10010
    M013:
    M013TW_1020
    MRSA252:
    SAR1061
    MSHR1132:
    SAMSHR1132_09350
    MSSA476:
    SAS1023
    Mu3:
    SAHV_1080
    Mu50:
    SAV1088
    MW2:
    MW0970
    RF122:
    SAB0954
    ST398:
    SAPIG1085
    T0131:
    SAT0131_01125
    TCH60:
    HMPREF0772_12145 (ktrA)
    TW20:
    SATW20_10830
    USA300_TCH1516:
    USA300HOU_1030
    VC40:
    SAVC_04600

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMK
    N315            MGKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMK
    NCTC8325        MGKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMK
    Newman          MGKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMK
    USA300_FPR3757  MGKEYVVIGLGRFGGSIVRELNALDMDVMAIDHDENRVNEYSDIATHAVVADTTDEAVMK
                    ************************************************************

    COL             SLGIRNFDHVIVAIGENIQSSTLTTLILKELGVKKVTAKAQNDYHAKILNKIGADTVVHP
    N315            SLGIRNFDHVIVAIGENIQSSTLTTLILKELGVKKVTAKAQNDYHAKILNKIGADTVVHP
    NCTC8325        SLGIRNFDHVIVAIGENIQSSTLTTLILKELGVKKVTAKAQNDYHAKILNKIGADTVVHP
    Newman          SLGIRNFDHVIVAIGENIQSSTLTTLILKELGVKKVTAKAQNDYHAKILNKIGADTVVHP
    USA300_FPR3757  SLGIRNFDHVIVAIGENIQSSTLTTLILKELGVKKVTAKAQNDYHAKILNKIGADTVVHP
                    ************************************************************

    COL             ERDMGRRIAHNVASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIK
    N315            ERDMGRRIAHNVASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIK
    NCTC8325        ERDMGRRIAHNVASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIK
    Newman          ERDMGRRIAHNVASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIK
    USA300_FPR3757  ERDMGRRIAHNVASASVLDYLELADEHSIVELKATEKMAGQSIIDLDIRAQYGINIIAIK
                    ************************************************************

    COL             RGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNIATR
    N315            RGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNIATR
    NCTC8325        RGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNIATR
    Newman          RGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNIATR
    USA300_FPR3757  RGKEFIISPNPNINLEIGDILIMIGHDNDLNRFEKNIATR
                    ****************************************