From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003312000
  • symbol?: rnjA
  • description?: beta-lactamase domain-containing protein

      descriptions from strain specific annotations:

    • beta-lactamase domain-containing protein
    • Zn-dependent hydrolase, RNA-metabolising, CPSF 73 kDa analog
    • ribonuclease J 1
    • mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily)
    • putative Zn-dependent hydrolase
    • metallo-beta-lactamase superfamily protein
    • protein_0989
  • strand?: -
  • coordinates?: 3680253..3681950
  • synteny block?: BlockID0023960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1046
    08BA02176:
    C248_1115
    11819-97:
    MS7_1046 (rnjA)
    71193:
    ST398NM01_1086
    ECT-R 2:
    ECTR2_944
    ED133:
    SAOV_1033c
    ED98:
    SAAV_1054
    HO 5096 0412:
    SAEMRSA15_09190
    JH1:
    SaurJH1_1171
    JH9:
    SaurJH9_1149
    JKD6008:
    SAA6008_01044
    JKD6159:
    SAA6159_00945
    LGA251:
    SARLGA251_10020
    M013:
    M013TW_1021
    MRSA252:
    SAR1063
    MSHR1132:
    SAMSHR1132_09360
    MSSA476:
    SAS1024
    Mu3:
    SAHV_1081
    Mu50:
    SAV1089
    MW2:
    MW0972
    RF122:
    SAB0955c
    ST398:
    SAPIG1086
    T0131:
    SAT0131_01126
    TCH60:
    HMPREF0772_12143
    TW20:
    SATW20_10840
    USA300_TCH1516:
    USA300HOU_1031
    VC40:
    SAVC_04605

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQLHPNEVGVYALGGLGEIGKNTYAVEYKDEIVIIDAGIKFPDDNLLGIDYVIPDYTYL
    N315            MKQLHPNEVGVYALGGLGEIGKNTYAVEYKDEIVIIDAGIKFPDDNLLGIDYVIPDYTYL
    NCTC8325        MKQLHPNEVGVYALGGLGEIGKNTYAVEYKDEIVIIDAGIKFPDDNLLGIDYVIPDYTYL
    Newman          MKQLHPNEVGVYALGGLGEIGKNTYAVEYKDEIVIIDAGIKFPDDNLLGIDYVIPDYTYL
    USA300_FPR3757  MKQLHPNEVGVYALGGLGEIGKNTYAVEYKDEIVIIDAGIKFPDDNLLGIDYVIPDYTYL
                    ************************************************************

    COL             VQNQDKIVGLFITHGHEDHIGGVPFLLKQLNIPIYGGPLALGLIRNKLEEHHLLRTAKLN
    N315            VQNQDKIVGLFITHGHEDHIGGVPFLLKQLNIPIYGGPLALGLIRNKLEEHHLLRTAKLN
    NCTC8325        VQNQDKIVGLFITHGHEDHIGGVPFLLKQLNIPIYGGPLALGLIRNKLEEHHLLRTAKLN
    Newman          VQNQDKIVGLFITHGHEDHIGGVPFLLKQLNIPIYGGPLALGLIRNKLEEHHLLRTAKLN
    USA300_FPR3757  VQNQDKIVGLFITHGHEDHIGGVPFLLKQLNIPIYGGPLALGLIRNKLEEHHLLRTAKLN
                    ************************************************************

    COL             EINEDSVIKSKHFTISFYLTTHSIPETYGVIVDTPEGKVVHTGDFKFDFTPVGKPANIAK
    N315            EINEDSVIKSKHFTISFYLTTHSIPETYGVIVDTPEGKVVHTGDFKFDFTPVGKPANIAK
    NCTC8325        EINEDSVIKSKHFTISFYLTTHSIPETYGVIVDTPEGKVVHTGDFKFDFTPVGKPANIAK
    Newman          EINEDSVIKSKHFTISFYLTTHSIPETYGVIVDTPEGKVVHTGDFKFDFTPVGKPANIAK
    USA300_FPR3757  EINEDSVIKSKHFTISFYLTTHSIPETYGVIVDTPEGKVVHTGDFKFDFTPVGKPANIAK
                    ************************************************************

    COL             MAQLGEEGVLCLLSDSTNSLVPDFTLSEREVGQNVDKIFRNCKGRIIFATFASNIYRVQQ
    N315            MAQLGEEGVLCLLSDSTNSLVPDFTLSEREVGQNVDKIFRNCKGRIIFATFASNIYRVQQ
    NCTC8325        MAQLGEEGVLCLLSDSTNSLVPDFTLSEREVGQNVDKIFRNCKGRIIFATFASNIYRVQQ
    Newman          MAQLGEEGVLCLLSDSTNSLVPDFTLSEREVGQNVDKIFRNCKGRIIFATFASNIYRVQQ
    USA300_FPR3757  MAQLGEEGVLCLLSDSTNSLVPDFTLSEREVGQNVDKIFRNCKGRIIFATFASNIYRVQQ
                    ************************************************************

    COL             AVEAAIKNNRKIVTFGRSMENNIKIGMELGYIKAPPETFIEPNKINTVPKHELLILCTGS
    N315            AVEAAIKNNRKIVTFGRSMENNIKIGMELGYIKAPPETFIEPNKINTVPKHELLILCTGS
    NCTC8325        AVEAAIKNNRKIVTFGRSMENNIKIGMELGYIKAPPETFIEPNKINTVPKHELLILCTGS
    Newman          AVEAAIKNNRKIVTFGRSMENNIKIGMELGYIKAPPETFIEPNKINTVPKHELLILCTGS
    USA300_FPR3757  AVEAAIKNNRKIVTFGRSMENNIKIGMELGYIKAPPETFIEPNKINTVPKHELLILCTGS
                    ************************************************************

    COL             QGEPMAALSRIANGTHKQIKIIPEDTVVFSSSPIPGNTKSINRTINSLYKAGADVIHSKI
    N315            QGEPMAALSRIANGTHKQIKIIPEDTVVFSSSPIPGNTKSINRTINSLYKAGADVIHSKI
    NCTC8325        QGEPMAALSRIANGTHKQIKIIPEDTVVFSSSPIPGNTKSINRTINSLYKAGADVIHSKI
    Newman          QGEPMAALSRIANGTHKQIKIIPEDTVVFSSSPIPGNTKSINRTINSLYKAGADVIHSKI
    USA300_FPR3757  QGEPMAALSRIANGTHKQIKIIPEDTVVFSSSPIPGNTKSINRTINSLYKAGADVIHSKI
                    ************************************************************

    COL             SNIHTSGHGSQGDQQLMLRLIKPKYFLPIHGEYRMLKAHGETGVECGVEEDNVFIFDIGD
    N315            SNIHTSGHGSQGDQQLMLRLIKPKYFLPIHGEYRMLKAHGETGVECGVEEDNVFIFDIGD
    NCTC8325        SNIHTSGHGSQGDQQLMLRLIKPKYFLPIHGEYRMLKAHGETGVECGVEEDNVFIFDIGD
    Newman          SNIHTSGHGSQGDQQLMLRLIKPKYFLPIHGEYRMLKAHGETGVECGVEEDNVFIFDIGD
    USA300_FPR3757  SNIHTSGHGSQGDQQLMLRLIKPKYFLPIHGEYRMLKAHGETGVECGVEEDNVFIFDIGD
                    ************************************************************

    COL             VLALTHDSARKAGRIPSGNVLVDGSGIGDIGNVVIRDRKLLSEEGLVIVVVSIDFNTNKL
    N315            VLALTHDSARKAGRIPSGNVLVDGSGIGDIGNVVIRDRKLLSEEGLVIVVVSIDFNTNKL
    NCTC8325        VLALTHDSARKAGRIPSGNVLVDGSGIGDIGNVVIRDRKLLSEEGLVIVVVSIDFNTNKL
    Newman          VLALTHDSARKAGRIPSGNVLVDGSGIGDIGNVVIRDRKLLSEEGLVIVVVSIDFNTNKL
    USA300_FPR3757  VLALTHDSARKAGRIPSGNVLVDGSGIGDIGNVVIRDRKLLSEEGLVIVVVSIDFNTNKL
                    ************************************************************

    COL             LSGPDIISRGFVYMRESGQLIYDAQRKIKTDVISKLNQNKDIQWHQIKSSIIETLQPYLF
    N315            LSGPDIISRGFVYMRESGQLIYDAQRKIKTDVISKLNQNKDIQWHQIKSSIIETLQPYLF
    NCTC8325        LSGPDIISRGFVYMRESGQLIYDAQRKIKTDVISKLNQNKDIQWHQIKSSIIETLQPYLF
    Newman          LSGPDIISRGFVYMRESGQLIYDAQRKIKTDVISKLNQNKDIQWHQIKSSIIETLQPYLF
    USA300_FPR3757  LSGPDIISRGFVYMRESGQLIYDAQRKIKTDVISKLNQNKDIQWHQIKSSIIETLQPYLF
                    ************************************************************

    COL             EKTARKPMILPVIMKVNEQKESNNK
    N315            EKTARKPMILPVIMKVNEQKESNNK
    NCTC8325        EKTARKPMILPVIMKVNEQKESNNK
    Newman          EKTARKPMILPVIMKVNEQKESNNK
    USA300_FPR3757  EKTARKPMILPVIMKVNEQKESNNK
                    *************************