From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003317000
  • symbol?: pdhA
  • description?: pyruvate dehydrogenase E1 component subunit alpha

      descriptions from strain specific annotations:

    • pyruvate dehydrogenase E1 component subunit alpha
    • pyruvate dehydrogenase E1 component alpha subunit
    • pyruvate dehydrogenase (acetyl-transferring)
    • pyrubate dehydrogenase E1 component alpha subunit
    • pyruvate dehydrogenase complex E1 component, alpha subunit
    • pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
    • pyruvate dehydrogenase complex E1 component subunit alpha
    • pyruvate dehydrogenase E1 component, alpha subunit
    • pyruvate dehydrogenase complex, E1 component subunit alpha
    • pyruvate dehydrogenase (acetyl-transferring) alpha subunit
    • putative pyruvate dehydrogenase E1 component,alpha subunit
    • putative pyruvate dehydrogenase E1 component subunit alpha
    • pyruvate dehydrogenase complex E1 component alpha subunit
    • pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  • strand?: +
  • coordinates?: 3684463..3685575
  • synteny block?: BlockID0024010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1102 (pdhA)
    N315:
    SA0943-1 (pdhA)
    NCTC8325:
    Newman:
    NWMN_0959 (phdA)
    USA300_FPR3757:
    04-02981:
    SA2981_1050 (pdhA)
    08BA02176:
    C248_1120 (pdhA)
    11819-97:
    MS7_1050 (pdhA)
    71193:
    ST398NM01_1090
    ECT-R 2:
    ECTR2_948 (pdhA)
    ED133:
    SAOV_1037
    ED98:
    SAAV_1058 (pdhA)
    HO 5096 0412:
    SAEMRSA15_09230 (pdhA)
    JH1:
    SaurJH1_1175
    JH9:
    SaurJH9_1153
    JKD6008:
    SAA6008_01048 (pdhA)
    JKD6159:
    SAA6159_00949 (pdhA)
    LGA251:
    SARLGA251_10060 (pdhA)
    M013:
    M013TW_1025
    MRSA252:
    SAR1067 (pdhA)
    MSHR1132:
    SAMSHR1132_09400
    MSSA476:
    SAS1028
    Mu3:
    SAHV_1085 (pdhA)
    Mu50:
    SAV1093 (pdhA)
    MW2:
    MW0976
    RF122:
    SAB0959 (pdhA)
    ST398:
    SAPIG1090 (pdhA)
    T0131:
    SAT0131_01130
    TCH60:
    HMPREF0772_12139 (pdhA)
    TW20:
    SATW20_10880 (pdhA)
    USA300_TCH1516:
    USA300HOU_1036 (pdhA)
    VC40:
    SAVC_04625

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
    N315            MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
    NCTC8325        MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
    Newman          MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
    USA300_FPR3757  MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
                    ************************************************************

    COL             LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
    N315            LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
    NCTC8325        LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
    Newman          LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
    USA300_FPR3757  LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
                    ************************************************************

    COL             FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
    N315            FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
    NCTC8325        FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
    Newman          FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
    USA300_FPR3757  FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
                    ************************************************************

    COL             GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
    N315            GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
    NCTC8325        GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
    Newman          GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
    USA300_FPR3757  GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
                    ************************************************************

    COL             LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
    N315            LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
    NCTC8325        LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
    Newman          LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
    USA300_FPR3757  LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
                    ************************************************************

    COL             FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
    N315            FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
    NCTC8325        FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
    Newman          FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
    USA300_FPR3757  FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
                    ************************************************************

    COL             YEIYKEKESK
    N315            YEIYKEKESK
    NCTC8325        YEIYKEKESK
    Newman          YEIYKEKESK
    USA300_FPR3757  YEIYKEKESK
                    **********