From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003322000
  • symbol?:
  • description?: XRE family transcriptional regulator

      descriptions from strain specific annotations:

    • XRE family transcriptional regulator
    • Cro/CI family transcriptional regulator
    • putative DNA-binding protein
    • Cro/CI family transcriptional regulator protein
    • DNA-binding protein
    • helix-turn-helix family protein
    • MerR family transcriptional regulator, nearpolyamine transporter
    • Spermidine/putrescine transport operon transcriptional regulator
    • transcriptional regulator, Cro/CI family
    • transcriptional regulator Cro/CI family
  • strand?: +
  • coordinates?: 3689953..3690492
  • synteny block?: BlockID0024060
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1055
    08BA02176:
    C248_1125
    11819-97:
    MS7_1055
    71193:
    ST398NM01_1095
    ECT-R 2:
    ECTR2_953
    ED133:
    SAOV_1042
    ED98:
    SAAV_1063
    HO 5096 0412:
    SAEMRSA15_09280
    JH1:
    SaurJH1_1180
    JH9:
    SaurJH9_1158
    JKD6008:
    SAA6008_01053
    JKD6159:
    SAA6159_00954
    LGA251:
    SARLGA251_10110
    M013:
    M013TW_1030
    MRSA252:
    SAR1072
    MSHR1132:
    SAMSHR1132_09450
    MSSA476:
    SAS1033
    Mu3:
    SAHV_1090
    Mu50:
    SAV1098
    MW2:
    MW0981
    RF122:
    SAB0964
    ST398:
    SAPIG1095
    T0131:
    SAT0131_01136
    TCH60:
    HMPREF0772_12134
    TW20:
    SATW20_10930
    USA300_TCH1516:
    USA300HOU_1041
    VC40:
    SAVC_04650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSE
    N315            MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSE
    NCTC8325        MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSE
    Newman          MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSE
    USA300_FPR3757  MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSE
                    ************************************************************

    COL             FFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPS
    N315            FFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPS
    NCTC8325        FFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPS
    Newman          FFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPS
    USA300_FPR3757  FFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPS
                    ************************************************************

    COL             ESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
    N315            ESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
    NCTC8325        ESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
    Newman          ESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
    USA300_FPR3757  ESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
                    ***********************************************************