From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01045
  • pan locus tag?: SAUPAN003322000
  • symbol: SAOUHSC_01045
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01045
  • symbol: SAOUHSC_01045
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1013880..1014419
  • length: 540
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAACATAGGTAATAAAATTAAAAATCTTAGAAGAATTAAAAATTTAACGCAAGAAGAA
    CTTGCTGAACGTACAGACTTATCGAAAGGCTACATTTCACAAATAGAAAGTGAACATGCC
    TCACCAAGTATGGAAACTTTCTTAAATATTATAGAGGTGTTAGGAACGACGCCAAGTGAA
    TTTTTTAAAGACAGTGAAAATGAAAAAGTATTATACAAGAAGGAAGAACAAGTTATTTAT
    GATGAGTATGATGAAGGTTATATATTAAATTGGTTAGTTTCAAAGTCAAATGAATATGAT
    ATGGAGCCATTAATATTAACTTTAAAGCCTGGAGCATCATATAAAAATTTTAATCCATCA
    GAGTCTGATACGTTTATTTATTGTATGTCAGGTCAGATAACACTTAATTTAGGCAAAGAG
    ATATATCAAGCACAAGAAGAAGACGTTTTGTATTTTAAAGCACGAGATAATCATCGTTTG
    TCAAACGAATCAAACAATGAAACACGAATACTTATTGTAGCGACAGCTTCATATTTATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01045
  • symbol: SAOUHSC_01045
  • description: hypothetical protein
  • length: 179
  • theoretical pI: 4.42625
  • theoretical MW: 20745.1
  • GRAVY: -0.602235

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 41.7)
    putative allantoin catabolism protein (TIGR03214; HMM-score: 36.2)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 19)
    Genetic information processingMobile and extrachromosomal element functionsOtheraddiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transductionRegulatory functionsDNA interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transductionRegulatory functionsProtein interactionsaddiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15.8)
    Hypothetical proteinsConservedTIGR00270 family protein (TIGR00270; HMM-score: 13.8)
  • TheSEED:  
    Amino Acids and DerivativesArginine; urea cycle, polyaminesPolyamine Metabolism Transcriptional regulator, MerR family, near polyamine transporter 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 54.3)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46.4)
    Cupin (CL0029) Cupin_2; Cupin domain (PF07883; HMM-score: 38.8)
    HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.1)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 24.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.9)
    Cupin (CL0029) Pirin_C; Pirin C-terminal cupin domain (PF05726; HMM-score: 21.8)
    AraC_binding; AraC-like ligand binding domain (PF02311; HMM-score: 20.2)
    HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.9)
    no clan definedDUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 17.8)
    Cupin (CL0029) CENP-C_C; Mif2/CENP-C like (PF11699; HMM-score: 16.8)
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 16.3)
    Cupin (CL0029) MannoseP_isomer; Mannose-6-phosphate isomerase (PF01050; HMM-score: 14.7)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.2)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 11
    • Cmax: 0.147
    • Cmax_pos: 41
    • Smax: 0.381
    • Smax_pos: 1
    • Smean: 0.23
    • D: 0.187
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSEFFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPSESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]