From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003324000
  • symbol?: potB
  • description?: spermidine/putrescine ABC transporter permease

      descriptions from strain specific annotations:

    • spermidine/putrescine ABC transporter permease
    • spermidine/putrescine ABC transporter permease protein
    • Spermidine/putrescine ABC transporter, permease protein
    • Spermidine Putrescine ABC transporter permease component potB
    • binding--dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane component family protein
    • binding-protein-dependent transport system inner membrane protein
    • pseudogene
    • putative ABC transport system permease
    • spermidine/putrescine ABC superfamily ATP binding cassette transporter, permease protein
    • spermidine/putrescine ABC transporter
  • strand?: +
  • coordinates?: 3691593..3692391
  • synteny block?: BlockID0024080
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0951 (potB)
    NCTC8325:
    Newman:
    NWMN_0966 (potB)
    USA300_FPR3757:
    04-02981:
    SA2981_1057 (potB)
    08BA02176:
    C248_1127
    11819-97:
    MS7_1057
    71193:
    ST398NM01_1097
    ECT-R 2:
    ECTR2_955
    ED133:
    SAOV_1044
    ED98:
    SAAV_1065
    HO 5096 0412:
    SAEMRSA15_09300
    JH1:
    SaurJH1_1182
    JH9:
    SaurJH9_1160
    JKD6008:
    SAA6008_01055 (potB)
    JKD6159:
    SAA6159_00956 (potB)
    LGA251:
    SARLGA251_10130
    M013:
    M013TW_1032
    MRSA252:
    SAR1074
    MSHR1132:
    SAMSHR1132_09470
    MSSA476:
    SAS1035
    Mu3:
    SAHV_1092 (potB)
    Mu50:
    SAV1100 (potB)
    MW2:
    MW0983 (potB)
    RF122:
    SAB0966
    ST398:
    SAPIG1097
    T0131:
    SAT0131_01138
    TCH60:
    HMPREF0772_12132 (potB)
    TW20:
    SATW20_10950
    USA300_TCH1516:
    VC40:
    SAVC_04660

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
    N315            MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
    NCTC8325        MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
    Newman          MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
    USA300_FPR3757  MRNTNKFLLIPYLLWMVIFIIVPVVLLIYFSFLDINGHFSFTNYQQIFTTKYLKMFAYSI
                    ************************************************************

    COL             LYAASITIITLTISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
    N315            LYAALITIITLAISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
    NCTC8325        LYAASITIITLTISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
    Newman          LYAASITIITLTISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
    USA300_FPR3757  LYAASITIITLTISYPAAYYITRSKFQNILLMIMIIPTWINLLLKTYAFIGLLSHDGVIN
                    **** ******:************************************************

    COL             QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
    N315            QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
    NCTC8325        QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
    Newman          QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
    USA300_FPR3757  QFFHLFNLPSFNLLFTTGAFLVVASYIYIPFMILPIFNSMKAIPNNLLQASSDLGASPFY
                    ************************************************************

    COL             TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
    N315            TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
    NCTC8325        TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
    Newman          TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
    USA300_FPR3757  TFRKVIMPLTKEGVMTGIQVTFIPSLSLFMITRLIAGNKVINIGTAIEEQFLTIQNYGMG
                    ************************************************************

    COL             STIAIFLIVFMAFILIITKSSNGRG
    N315            STIAIFLIVFMAFILIITKSSNGRG
    NCTC8325        STIAIFLIVFMAFILIITKSSNGRG
    Newman          STIAIFLIVFMAFILIITKSSNGRG
    USA300_FPR3757  STIAIFLIVFMAFILIITKSSNGRG
                    *************************