From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003327000
  • symbol?:
  • description?: membrane protein
  • strand?: +
  • coordinates?: 3694354..3695373
  • synteny block?: BlockID0024110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1060
    08BA02176:
    C248_1130
    11819-97:
    MS7_1060
    71193:
    ST398NM01_1100
    ECT-R 2:
    ECTR2_958
    ED133:
    SAOV_1047
    ED98:
    SAAV_1068
    HO 5096 0412:
    SAEMRSA15_09330
    JH1:
    SaurJH1_1185
    JH9:
    SaurJH9_1163
    JKD6008:
    SAA6008_01058
    JKD6159:
    SAA6159_00959
    LGA251:
    SARLGA251_10160
    M013:
    M013TW_1035
    MRSA252:
    SAR1077
    MSHR1132:
    SAMSHR1132_09500
    MSSA476:
    SAS1038
    Mu3:
    SAHV_1095
    Mu50:
    SAV1103
    MW2:
    MW0986
    RF122:
    SAB0969
    ST398:
    SAPIG1100
    T0131:
    SAT0131_01142
    TCH60:
    HMPREF0772_12129
    TW20:
    SATW20_10980
    USA300_TCH1516:
    USA300HOU_1044
    VC40:
    SAVC_04675

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTGEQFTQIKRPVSRLTEKVLGWLCWVMLLVLTVITMFIALVSFSNNTSIANLENTLNNN
    N315            MTGEQFTQIKRPVSRLTEKVLGWLCWVMLLVLTVITMFIALVSFSNNTSIANLENTLNNN
    NCTC8325        MTGEQFTQIKRPVSRLTEKVLGWLCWVMLLVLTVITMFIALVSFSNNTSIANLENTLNNN
    Newman          MTGEQFTQIKRPVSRLTEKVLGWLCWVMLLVLTVITMFIALVSFSNNTSIANLENTLNNN
    USA300_FPR3757  MTGEQFTQIKRPVSRLTEKVLGWLCWVMLLVLTVITMFIALVSFSNNTSIANLENTLNNN
                    ************************************************************

    COL             AFIQQLLAGNGYNTTQFVIWLQNGIWAIIVYFIVCLLISFLALISMNIRILSGFLFLISA
    N315            AFIQQLLAGNGYNTTQFVIWLQNGIWAIIVYFIVCLLISFLALISMNIRILSGFLFLISA
    NCTC8325        AFIQQLLAGNGYNTTQFVIWLQNGIWAIIVYFIVCLLISFLALISMNIRILSGFLFLISA
    Newman          AFIQQLLAGNGYNTTQFVIWLQNGIWAIIVYFIVCLLISFLALISMNIRILSGFLFLISA
    USA300_FPR3757  AFIQQLLAGNGYNTTQFVIWLQNGIWAIIVYFIVCLLISFLALISMNIRILSGFLFLISA
                    ************************************************************

    COL             IVTIPLVLLIVTLIIPILFFIIAMMLFIRKDKVEMVAPQYYEEYNGPIYDYREPVYERPQ
    N315            IVTIPLVLLIVTLIIPILFFIIAMMLFIRKDKVEMVAPQYYEEYNGPIYDYREPVYERPQ
    NCTC8325        IVTIPLVLLIVTLIIPILFFIIAMMLFIRKDKVEMVAPQYYEEYNGPIYDYREPVYERPQ
    Newman          IVTIPLVLLIVTLIIPILFFIIAMMLFIRKDKVEMVAPQYYEEYNGPIYDYREPVYERPQ
    USA300_FPR3757  IVTIPLVLLIVTLIIPILFFIIAMMLFIRKDKVEMVAPQYYEEYNGPIYDYREPVYERPQ
                    ************************************************************

    COL             PKDDYYDVPKYEKELDKSNTVYDQEQERDKYDQFPKRAVESEYNHDERTEEEPSVLSRQA
    N315            PKDDYYDVPKYEKELDKSNTVYDQEQERDKYDQFPKRAVESEYNHDERTEEEPSVLSRQA
    NCTC8325        PKDDYYDVPKYEKELDKSNTVYDQEQERDKYDQFPKRAVESEYNHDERTEEEPSVLSRQA
    Newman          PKDDYYDVPKYEKELDKSNTVYDQEQERDKYDQFPKRAVESEYNHDERTEEEPSVLSRQA
    USA300_FPR3757  PKDDYYDVPKYEKELDKSNTVYDQEQERDKYDQFPKRAVESEYNHDERTEEEPSVLSRQA
                    ************************************************************

    COL             KYKQKSTEELGIEDDGYYAEPEVDPKELKAQQKREKAEIKAKKKEKRKAYNQRMKERRKN
    N315            KYKQKSTEELGIEDDGYYAEPEVDPKELKAQQKREKAEIKAKKKEKRKAYNQRMKERRKN
    NCTC8325        KYKQKSTEELGIEDDGYYAEPEVDPKELKAQQKREKAEIKAKKKEKRKAYNQRMKERRKN
    Newman          KYKQKSTEELGIEDDGYYAEPEVDPKELKAQQKREKAEIKAKKKEKRKAYNQRMKERRKN
    USA300_FPR3757  KYKQKSTEELGIEDDGYYAEPEVDPKELKAQQKREKAEIKAKKKEKRKAYNQRMKERRKN
                    ************************************************************

    COL             QPSAVSQRRMNFEERRQIYNNDISEERNSSEVKDKKEQE
    N315            QPSAVSQRRMNFEERRQIYNNDISEERNSSEVKDKKEQE
    NCTC8325        QPSAVSQRRMNFEERRQIYNNDISEERNSSEVKDKKEQE
    Newman          QPSAVSQRRMNFEERRQIYNNDISEERNSSEVKDKKEQE
    USA300_FPR3757  QPSAVSQRRMNFEERRQIYNNDISEERNSSEVKDKKEQE
                    ***************************************