From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003336000
  • symbol?: typA
  • description?: translational GTPase TypA

      descriptions from strain specific annotations:

    • translational GTPase TypA
    • GTP-binding protein TypA
    • GTP-binding protein
    • small GTP-binding protein domain:GTP-binding protein TypA
    • BipA family GTPase
    • GTP-binding elongation factor homologue
    • GTP-binding elongation factor-like protein
    • GTP-binding elongation factor protein
    • GTP-binding protein, TypA
    • GTP-binding protein TypA/BipA
  • strand?: +
  • coordinates?: 3701431..3703314
  • synteny block?: BlockID0024200
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1118 (typA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1066 (typA)
    08BA02176:
    C248_1136
    11819-97:
    MS7_1066 (typA)
    71193:
    ST398NM01_1106
    ECT-R 2:
    ECTR2_964 (typA)
    ED133:
    SAOV_1052
    ED98:
    SAAV_1075 (typA)
    HO 5096 0412:
    SAEMRSA15_09390
    JH1:
    SaurJH1_1191
    JH9:
    SaurJH9_1169
    JKD6008:
    SAA6008_01064 (typA)
    JKD6159:
    SAA6159_00965 (typA)
    LGA251:
    SARLGA251_10220
    M013:
    M013TW_1041
    MRSA252:
    SAR1083
    MSHR1132:
    SAMSHR1132_09560
    MSSA476:
    SAS1044
    Mu3:
    SAHV_1101
    Mu50:
    SAV1109
    MW2:
    MW0992
    RF122:
    SAB0974
    ST398:
    SAPIG1106 (typA)
    T0131:
    SAT0131_01148 (lacF)
    TCH60:
    HMPREF0772_12123 (typA)
    TW20:
    SATW20_11040
    USA300_TCH1516:
    USA300HOU_1047
    VC40:
    SAVC_04710

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
    N315            MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
    NCTC8325        MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
    Newman          MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
    USA300_FPR3757  MTNKREDVRNIAIIAHVDHGKTTLVDELLKQSGIFRENEHVDERAMDSNDIERERGITIL
                    ************************************************************

    COL             AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
    N315            AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
    NCTC8325        AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
    Newman          AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
    USA300_FPR3757  AKNTAVDYKGTRINILDTPGHADFGGEVERIMKMVDGVVLVVDAYEGTMPQTRFVLKKAL
                    ************************************************************

    COL             EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
    N315            EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
    NCTC8325        EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
    Newman          EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
    USA300_FPR3757  EQNLKPVVVVNKIDKPSARPEGVVDEVLDLFIELEANDEQLEFPVVYASAVNGTASLDPE
                    ************************************************************

    COL             KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
    N315            KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
    NCTC8325        KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
    Newman          KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
    USA300_FPR3757  KQDDNLQSLYETIIDYVPAPIDNSDEPLQFQVALLDYNDYVGRIGIGRVFRGKMRVGDNV
                    ************************************************************

    COL             SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
    N315            SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
    NCTC8325        SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
    Newman          SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
    USA300_FPR3757  SLIKLDGTVKNFRVTKIFGYFGLKRLEIEEAQAGDLIAVSGMEDINVGETVTPHDHQEAL
                    ************************************************************

    COL             PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
    N315            PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
    NCTC8325        PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
    Newman          PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
    USA300_FPR3757  PVLRIDEPTLEMTFKVNNSPFAGREGDFVTARQIQERLNQQLETDVSLKVSNTDSPDTWV
                    ************************************************************

    COL             VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
    N315            VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
    NCTC8325        VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
    Newman          VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
    USA300_FPR3757  VAGRGELHLSILIENMRREGYELQVSKPQVIIKEIDGVMCEPFERVQCEVPQENAGAVIE
                    ************************************************************

    COL             SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
    N315            SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
    NCTC8325        SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
    Newman          SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
    USA300_FPR3757  SLGARKGEMVDMTTTDNGLTRLIFNVPARGMIGYTTEFMSMTRGYGIINHTFEEFRPRIK
                    ************************************************************

    COL             AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
    N315            AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
    NCTC8325        AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
    Newman          AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
    USA300_FPR3757  AQIGGRRNGALISMDQGSASTYAILGLEDRGVNFMEPGTEVYEGMIVGEHNRENDLTVNI
                    ************************************************************

    COL             TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVVVTPESIRLRKKILNKNVR
    N315            TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
    NCTC8325        TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
    Newman          TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
    USA300_FPR3757  TKTKHQTNVRSATKDQTQTMNRPRILTLEEALQFINDDELVEVTPESIRLRKKILNKNVR
                    ***************************************** ******************

    COL             EKEAKRIKQMMQENE
    N315            EKEAKRIKQMMQENE
    NCTC8325        EKEAKRIKQMMQENE
    Newman          EKEAKRIKQMMQENE
    USA300_FPR3757  EKEAKRIKQMMQENE
                    ***************