From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003360000
  • symbol?: isdC
  • description?: surface anchored protein

      descriptions from strain specific annotations:

    • surface anchored protein
    • iron transport associated domain-containing protein
    • NEAr transporter
    • iron-regulated cell surface protein
    • iron (Fe2+)-regulated surface determinant protein IsdC
    • Iron-regulated surface determinant protein C precursor
    • putative surface protein
    • NPQTN cell wall anchored protein IsdC
    • sortase B signal domain, NPQTN class domain protein
    • NPQTN cell wall surface anchor protein
    • heme uptake protein IsdC
    • putative surface anchored protein
    • iron-regulated surface determinant protein C (Staphylococcaliron-regulated protein D)
  • strand?: +
  • coordinates?: 3727275..3727959
  • synteny block?: BlockID0024430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1141 (isdC)
    N315:
    SA0978 (isdC)
    NCTC8325:
    Newman:
    NWMN_1042 (isdC)
    USA300_FPR3757:
    04-02981:
    SA2981_1087 (isdC)
    08BA02176:
    C248_1157 (isdC)
    11819-97:
    MS7_1087 (isdC)
    71193:
    ST398NM01_1127
    ECT-R 2:
    ECTR2_985
    ED133:
    SAOV_1127 (isdC)
    ED98:
    SAAV_1097 (isdC)
    HO 5096 0412:
    SAEMRSA15_09600 (isdC)
    JH1:
    SaurJH1_1212
    JH9:
    SaurJH9_1190
    JKD6008:
    SAA6008_01085 (isdC)
    JKD6159:
    SAA6159_00985 (isdC)
    LGA251:
    SARLGA251_10430 (isdC)
    M013:
    M013TW_1062
    MRSA252:
    SAR1104 (isdC)
    MSHR1132:
    SAMSHR1132_09770
    MSSA476:
    SAS1065
    Mu3:
    SAHV_1122
    Mu50:
    SAV1131
    MW2:
    MW1013 (isdC)
    RF122:
    SAB0995 (isdC)
    ST398:
    SAPIG1127
    T0131:
    SAT0131_01170
    TCH60:
    HMPREF0772_12102 (isdC)
    TW20:
    SATW20_11250 (isdC)
    USA300_TCH1516:
    USA300HOU_1065 (isdC)
    VC40:
    SAVC_04815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNILKVFNTTILALIIIIATFSNSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYI
    N315            MKNILKVFNTTILALIIIIATFSNSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYI
    NCTC8325        MKNILKVFNTTILALIIIIATFSNSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYI
    Newman          MKNILKVFNTTILALIIIIATFSNSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYI
    USA300_FPR3757  MKNILKVFNTTILALIIIIATFSNSANAADSGTLNYEVYKYNTNDTSIANDYFNKPAKYI
                    ************************************************************

    COL             KKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVY
    N315            KKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVY
    NCTC8325        KKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVY
    Newman          KKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVY
    USA300_FPR3757  KKNGKLYVQITVNHSHWITGMSIEGHKENIISKNTAKDERTSEFEVSKLNGKIDGKIDVY
                    ************************************************************

    COL             IDEKVNGKPFKYDHHYNITYKFNGPTDVAGANAPGKDDKNSASGSDKGSDGTTTGQSESN
    N315            IDEKVNGKPFKYDHHYNITYKFNGPTDVAGANAPGKDDKNSASGSDKGSDGTTTGQSESN
    NCTC8325        IDEKVNGKPFKYDHHYNITYKFNGPTDVAGANAPGKDDKNSASGSDKGSDGTTTGQSESN
    Newman          IDEKVNGKPFKYDHHYNITYKFNGPTDVAGANAPGKDDKNSASGSDKGSDGTTTGQSESN
    USA300_FPR3757  IDEKVNGKPFKYDHHYNITYKFNGPTDVAGANAPGKDDKNSASGSDKGSDGTTTGQSESN
                    ************************************************************

    COL             SSNKDKVENPQTNAGTPAYIYTIPVASLALLIAITLFVRKKSKGNVE
    N315            SSNKDKVENPQTNAGTPAYIYAIPVASLALLIAITLFVRKKSKGNVE
    NCTC8325        SSNKDKVENPQTNAGTPAYIYAIPVASLALLIAITLFVRKKSKGNVE
    Newman          SSNKDKVENPQTNAGTPAYIYAIPVASLALLIAITLFVRKKSKGNVE
    USA300_FPR3757  SSNKDKVENPQTNAGTPAYIYAIPVASLALLIAITLFVRKKSKGNVE
                    *********************:*************************