From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003364000
  • symbol?: isdF
  • description?: heme-iron transport system permease protein isdF

      descriptions from strain specific annotations:

    • heme-iron transport system permease protein isdF
    • iron transport permease SirG
    • iron compound ABC transporter permease
    • Heme transporter IsdDEF, permease component IsdF
    • iron transport permease protein
    • iron/heme permease
    • fecCD transport family protein
    • iron (Fe3+) ABC transporter membrane protein
    • heme ABC transporter, iron transport permease protein IsdF
    • iron/heme complex transport system permease protein
  • strand?: +
  • coordinates?: 3729923..3730703
  • synteny block?: BlockID0024470
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0981 (isdF)
    NCTC8325:
    Newman:
    NWMN_1045 (isdF)
    USA300_FPR3757:
    04-02981:
    SA2981_1090 (isdF)
    08BA02176:
    C248_1160 (isdF)
    11819-97:
    MS7_1090
    71193:
    ST398NM01_1130
    ECT-R 2:
    ECTR2_988
    ED133:
    SAOV_1130 (isdF)
    ED98:
    SAAV_1100 (isdF)
    HO 5096 0412:
    SAEMRSA15_09630 (isdF)
    JH1:
    SaurJH1_1215
    JH9:
    SaurJH9_1193
    JKD6008:
    SAA6008_01088 (isdF)
    JKD6159:
    SAA6159_00988 (isdF)
    LGA251:
    SARLGA251_10460 (isdF)
    M013:
    M013TW_1067
    MRSA252:
    SAR1107 (isdF)
    MSHR1132:
    SAMSHR1132_09800
    MSSA476:
    SAS1068
    Mu3:
    SAHV_1125
    Mu50:
    SAV1134
    MW2:
    MW1016 (isdF)
    RF122:
    SAB0998 (isdF)
    ST398:
    SAPIG1130
    T0131:
    SAT0131_01173 (budA1)
    TCH60:
    HMPREF0772_12099 (isdF)
    TW20:
    SATW20_11280 (isdF)
    USA300_TCH1516:
    USA300HOU_1068 (isdF)
    VC40:
    SAVC_04830

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MIKNKKKLLFLCLLVILIATAYISFVTGTIKLSFNDLFTKFTTGSNEAVDSIIDLRLPR
    N315            -------------------------------------------------MDSIIDLRLPR
    NCTC8325        -MIKNKKKLLFLCLLVILIATAYISFVTGTIKLSFNDLFTKFTTGSNEAVDSIIDLRLPR
    Newman          MMIKNKKKLLFLCLLVILIATAYISFVTGTIKLSFNDLFTKFTTGSNEAVDSIIDLRLPR
    USA300_FPR3757  -MIKNKKKLLFLCLLVILIATAYISFVTGTIKLSFNDLFTKFTTGSNEAVDSIIDLRLPR
                                                                     :**********

    COL             ILIALMVGAMLAVSGALLQAALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLS
    N315            ILIALMVGAMLAVSGALLQAALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLS
    NCTC8325        ILIALMVGAMLAVSGALLQAALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLS
    Newman          ILIALMVGAMLAVSGALLQAALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLS
    USA300_FPR3757  ILIALMVGAMLAVSGALLQAALQNPLAEANIIGVSSGALIMRALCMLFIPQLYFYLPLLS
                    ************************************************************

    COL             FIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVLEILTQNPLMKIPQGLTMKIW
    N315            FIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVLEILTQNPLMKIPQGLTMKIW
    NCTC8325        FIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVLEILTQNPLMKIPQGLTMKIW
    Newman          FIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVLEILTQNPLMKIPQGLTMKIW
    USA300_FPR3757  FIGGLIPFLIIILLHSKFRFNAVSMILVGVALFVLLNGVLEILTQNPLMKIPQGLTMKIW
                    ************************************************************

    COL             SDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
    N315            SDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
    NCTC8325        SDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
    Newman          SDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
    USA300_FPR3757  SDVYILAVSALLGLILTLLLSPKLNLLNLDDIQARSIGFNIDRYRWLTGLLAVFLASATV
                    ************************************************************

    COL             AIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANA
    N315            AIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANA
    NCTC8325        AIVGQLAFLGIIV-HM---------------------WL---------------------
    Newman          AIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANA
    USA300_FPR3757  AIVGQLAFLGIIVPHVVRKLVGGNYRVLIPFSTVIGAWLLLVADLLGRVIQPPLEIPANA
                    ************* *:                     **                     

    COL             ILMIVGGPMLIYLICQSQRNRI
    N315            ILMIVGGPMLIYLICQSQRNRI
    NCTC8325        --------------------ES
    Newman          ILMIVGGPMLIYLICQSQRNRI
    USA300_FPR3757  ILMIVGGPMLIYLICQSQRNRI
                                        .