From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003368000
  • symbol?: isdG
  • description?: heme-degrading monooxygenase IsdG

      descriptions from strain specific annotations:

    • heme-degrading monooxygenase IsdG
    • monooxygenase IsdI
    • antibiotic biosynthesis monooxygenase family protein
    • cytosolic heme degrading enzyme
    • Heme-degrading cytoplasmic oxygenase IsdG
    • heme-degrading monooxygenase IsdG (Iron-regulatedsurface determinant isdG) (Iron-responsive surface determinant isdG)(Heme oxygenase)
    • iron (Fe2+)-regulated surface determinant protein IsdG
  • strand?: +
  • coordinates?: 3732516..3732839
  • synteny block?: BlockID0024510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA0983 (isdG)
    NCTC8325:
    Newman:
    NWMN_1047 (isdG)
    USA300_FPR3757:
    04-02981:
    SA2981_1092 (isdG)
    08BA02176:
    C248_1162
    11819-97:
    MS7_1092 (isdG)
    71193:
    ST398NM01_1132
    ECT-R 2:
    ECTR2_990
    ED133:
    SAOV_1132
    ED98:
    SAAV_1102
    HO 5096 0412:
    SAEMRSA15_09650
    JH1:
    SaurJH1_1217
    JH9:
    SaurJH9_1195
    JKD6008:
    SAA6008_01090 (isdG)
    JKD6159:
    SAA6159_00990 (isdG)
    LGA251:
    SARLGA251_10480 (isdG)
    M013:
    M013TW_1069
    MRSA252:
    SAR1109
    MSHR1132:
    SAMSHR1132_09820
    MSSA476:
    SAS1070
    Mu3:
    SAHV_1127
    Mu50:
    SAV1136 (isdG)
    MW2:
    MW1018 (isdG)
    RF122:
    SAB1000
    ST398:
    SAPIG1132
    T0131:
    SAT0131_01176
    TCH60:
    HMPREF0772_12097 (isdG)
    TW20:
    SATW20_11300 (isdG)
    USA300_TCH1516:
    USA300HOU_1069 (isdG2)
    VC40:
    SAVC_04845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKS
    N315            MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKS
    NCTC8325        MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKS
    Newman          MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKS
    USA300_FPR3757  MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKS
                    ************************************************************

    COL             KQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
    N315            KQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
    NCTC8325        KQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
    Newman          KQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
    USA300_FPR3757  KQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK
                    ***********************************************