From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • pan locus tag?: SAUPAN003368000
  • symbol: isdG
  • pan gene symbol?: isdG
  • synonym:
  • product: heme-degrading monooxygenase IsdG

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • symbol: isdG
  • product: heme-degrading monooxygenase IsdG
  • replicon: chromosome
  • strand: +
  • coordinates: 1112486..1112809
  • length: 324
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGAAATTTATGGCAGAAAATAGGCTGACGTTAACAAAAGGAACAGCAAAAGATATTATA
    GAACGATTTTACACGAGACATGGGATTGAAACATTAGAAGGCTTTGATGGCATGTTTGTT
    ACACAAACTTTAGAACAAGAAGATTTTGATGAAGTGAAAATTTTAACAGTTTGGAAATCA
    AAGCAAGCTTTTACGGATTGGTTAAAATCTGATGTCTTTAAAGCAGCGCATAAACATGTT
    AGAAGTAAAAATGAAGATGAAAGTAGCCCGATTATCAATAACAAAGTAATTACATATGAT
    ATAGGCTATAGTTACATGAAATAA
    60
    120
    180
    240
    300
    324

Protein[edit source | edit]

Protein Data Bank: 2ZDO

General[edit source | edit]

  • locus tag: SA0983 [new locus tag: SA_RS05570 ]
  • symbol: IsdG
  • description: heme-degrading monooxygenase IsdG
  • length: 107
  • theoretical pI: 6.80692
  • theoretical MW: 12546.2
  • GRAVY: -0.566355

Function[edit source | edit]

  • reaction:
    EC 1.14.99.48?  ExPASy
    Heme oxygenase (staphylobilin-producing)Protoheme + 4 AH2 + 4 O2 = 5-oxo-delta-bilirubin + Fe2+ + CO + 4 A + 4 H2OProtoheme + 4 AH2 + 4 O2 = 15-oxo-beta-bilirubin + Fe2+ + CO + 4 A + 4 H2O
    EC 1.14.99.3?  ExPASy
    Transferred entry: 1.14.14.18
  • TIGRFAM:
    MetabolismAmino acid biosynthesisAspartate familyhomoserine O-succinyltransferase (TIGR01001; EC 2.3.1.46; HMM-score: 15.8)
  • TheSEED:  
    Heme, hemin uptake and utilization systems in GramPositives Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48) 
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 53)
    Glutaminase_I (CL0014) HTS; Homoserine O-succinyltransferase (PF04204; HMM-score: 15)
    Dim_A_B_barrel (CL0032) Dehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 14.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 11
    • Cmax: 0.108
    • Cmax_pos: 29
    • Smax: 0.318
    • Smax_pos: 1
    • Smean: 0.179
    • D: 0.158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHVRSKNEDESSPIINNKVITYDIGYSYMK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1329 (Fur*)
    Fur* (TF) important in Iron homeostasisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Woo Cheol Lee, Michelle L Reniere, Eric P Skaar, Michael E P Murphy
Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus.
J. Biol. Chem.: 2008, 283(45);30957-63
[PubMed:18713745] [WorldCat.org] [DOI] (P p)
Michelle L Reniere, Georgia N Ukpabi, S Reese Harry, Donald F Stec, Robert Krull, David W Wright, Brian O Bachmann, Michael E Murphy, Eric P Skaar
The IsdG-family of haem oxygenases degrades haem to a novel chromophore.
Mol. Microbiol.: 2010, 75(6);1529-38
[PubMed:20180905] [WorldCat.org] [DOI] (I p)