From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0980 [new locus tag: SA_RS05555 ]
  • pan locus tag?: SAUPAN003363000
  • symbol: isdE
  • pan gene symbol?: isdE
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0980 [new locus tag: SA_RS05555 ]
  • symbol: isdE
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1109815..1110693
  • length: 879
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    TTGAGAATCATAAAGTATTTAACCATTTTAGTGATAAGCGTCGTTATCTTAACCAGCTGT
    CAATCTTCCAGTTCTCAAGAATCAACTAAATCCGGCGAATTCAGAATCGTACCAACAACT
    GTTGCATTGACAATGACATTGGACAAATTGGATTTACCAATTGTCGGCAAACCCACGTCA
    TATAAGACATTGCCTAATCGTTATAAAGATGTACCGGAAATTGGTCAACCAATGGAGCCG
    AATGTTGAAGCTGTTAAAAAGTTAAAACCAACACATGTTTTGAGTGTGTCAACGATTAAA
    GATGAAATGCAACCATTTTACAAACAATTAAATATGAAAGGCTACTTTTATGATTTTGAT
    AGTTTAAAAGGGATGCAAAAGTCGATTACACAATTAGGTGATCAATTTAATCGTAAAGCA
    CAAGCAAAAGAATTAAATGACCATTTAAATTCTGTAAAGCAAAAAATTGAAAATAAAGCA
    GCTAAACAAAAGAAACATCCCAAAGTATTAATATTAATGGGTGTACCGGGTAGCTATTTA
    GTAGCAACTGATAAATCATATATTGGTGATTTAGTTAAAATAGCAGGTGGAGAAAATGTT
    ATTAAAGTGAAAGATCGTCAATATATTTCGTCTAATACTGAAAATTTGTTGAATATCAAT
    CCAGATATTATTTTACGATTACCACACGGAATGCCTGAAGAAGTTAAGAAAATGTTTCAA
    AAAGAATTTAAACAAAATGATATTTGGAAACATTTTAAAGCTGTGAAAAATAATCATGTT
    TATGACTTAGAGGAAGTGCCATTCGGTATTACAGCAAATGTTGATGCTGATAAGGCAATG
    ACTCAATTATATGATTTATTTTATAAGGATAAAAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    879

Protein[edit source | edit]

Protein Data Bank: 2Q8P
Protein Data Bank: 2Q8Q

General[edit source | edit]

  • locus tag: SA0980 [new locus tag: SA_RS05555 ]
  • symbol: IsdE
  • description: hypothetical protein
  • length: 292
  • theoretical pI: 9.91166
  • theoretical MW: 33270.5
  • GRAVY: -0.440753

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    heme ABC transporter, heme-binding protein isdE (TIGR03659; HMM-score: 411.6)
    putative ABC transporter PGF-CTERM-modified substrate-binding protein (TIGR04281; HMM-score: 43.7)
    Cell structureCell envelopeOtheruncharacterized lipoprotein (TIGR02722; HMM-score: 13.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtwin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 7.5)
  • TheSEED:  
    Iron acquisition and metabolismIron acquisition and metabolism - no subcategoryHeme, hemin uptake and utilization systems in GramPositives Heme transporter IsdDEF, lipoprotein IsdE 
  • PFAM:
    Chelatase (CL0043) Peripla_BP_2; Periplasmic binding protein (PF01497; HMM-score: 138.6)
    no clan definedMuted; Organelle biogenesis, Muted-like protein (PF14942; HMM-score: 17.1)
    HAD (CL0137) NT5C; 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C) (PF06941; HMM-score: 15.9)
    no clan definedDUF2098; Uncharacterized protein conserved in archaea (DUF2098) (PF09871; HMM-score: 14.9)
    PK_TIM (CL0151) ICL; Isocitrate lyase family (PF00463; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: heme b
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 28 aa
    • Ymax: 0.534
    • Ymax_pos: 28
    • Cmax: 0.387
    • Cmax_pos: 28
    • Smax: 0.913
    • Smax_pos: 17
    • Smean: 0.755
    • D: 0.62
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRIIKYLTILVISVVILTSCQSSSSQESTKSGEFRIVPTTVALTMTLDKLDLPIVGKPTSYKTLPNRYKDVPEIGQPMEPNVEAVKKLKPTHVLSVSTIKDEMQPFYKQLNMKGYFYDFDSLKGMQKSITQLGDQFNRKAQAKELNDHLNSVKQKIENKAAKQKKHPKVLILMGVPGSYLVATDKSYIGDLVKIAGGENVIKVKDRQYISSNTENLLNINPDIILRLPHGMPEEVKKMFQKEFKQNDIWKHFKAVKNNHVYDLEEVPFGITANVDADKAMTQLYDLFYKDKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: SA1329 (Fur*)
    Fur* (TF) important in Iron homeostasisRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Jason C Grigg, Christie L Vermeiren, David E Heinrichs, Michael E P Murphy
Heme coordination by Staphylococcus aureus IsdE.
J. Biol. Chem.: 2007, 282(39);28815-22
[PubMed:17666394] [WorldCat.org] [DOI] (P p)