From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003385000
  • symbol?: uvrC
  • description?: excinuclease ABC subunit C

      descriptions from strain specific annotations:

    • excinuclease ABC subunit C
    • excinuclease ABC, C subunit
    • excision endonuclease subunit UvrC
    • glycosyl transferase family protein
    • putative excinuclease ABC subunit C
    • UvrABC system protein C
  • strand?: +
  • coordinates?: 3747159..3748940
  • synteny block?: BlockID0024680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1157 (uvrC)
    N315:
    SA0993 (uvrC)
    NCTC8325:
    Newman:
    NWMN_1058 (uvrC)
    USA300_FPR3757:
    04-02981:
    SA2981_1102 (uvrC)
    08BA02176:
    C248_1174 (uvrC)
    11819-97:
    MS7_1103 (uvrC)
    71193:
    ST398NM01_1142
    ECT-R 2:
    ECTR2_1000 (uvrC)
    ED133:
    SAOV_1143
    ED98:
    SAAV_1114 (uvrC)
    HO 5096 0412:
    SAEMRSA15_09760 (uvrC)
    JH1:
    SaurJH1_1227 (uvrC)
    JH9:
    SaurJH9_1205 (uvrC)
    JKD6008:
    SAA6008_01100 (uvrC)
    JKD6159:
    SAA6159_01000 (uvrC)
    LGA251:
    SARLGA251_10580 (uvrC)
    M013:
    M013TW_1079
    MRSA252:
    SAR1119 (uvrC)
    MSHR1132:
    SAMSHR1132_09920
    MSSA476:
    SAS1080 (uvrC)
    Mu3:
    SAHV_1137 (uvrC)
    Mu50:
    SAV1146 (uvrC)
    MW2:
    MW1029 (uvrC)
    RF122:
    SAB1010 (uvrC)
    ST398:
    SAPIG1142 (uvrC)
    T0131:
    SAT0131_01188
    TCH60:
    HMPREF0772_12087 (uvrC)
    TW20:
    SATW20_11400 (uvrC)
    USA300_TCH1516:
    USA300HOU_1082 (uvrC)
    VC40:
    SAVC_04895 (uvrC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEDYKQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLV
    N315            MEDYKQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLV
    NCTC8325        MEDYKQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLV
    Newman          MEDYKQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLV
    USA300_FPR3757  MEDYKQRIKNKLNVVPMEPGCYLMKDRNDQVIYVGKAKKLRNRLRSYFTGAHDAKTTRLV
                    ************************************************************

    COL             GEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTRT
    N315            GEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTRT
    NCTC8325        GEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTRT
    Newman          GEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTRT
    USA300_FPR3757  GEIRRFEFIVTSSETESLLLELNLIKQYQPRYNILLKDDKSYPFIKITKEKYPRLLVTRT
                    ************************************************************

    COL             VKQGTGKYFGPYPNAYSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDL
    N315            VKQGTGKYFGPYPNAYSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDL
    NCTC8325        VKQGTGKYFGPYPNAYSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDL
    Newman          VKQGTGKYFGPYPNAYSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDL
    USA300_FPR3757  VKQGTGKYFGPYPNAYSAQETKKLLDRIYPYRKCDKMPDKLCLYYHIGQCLGPCVYDVDL
                    ************************************************************

    COL             SKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKI
    N315            SKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKI
    NCTC8325        SKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKI
    Newman          SKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKI
    USA300_FPR3757  SKYAQMTKEITDFLNGEDKTILKSLEERMLTASESLDFERAKEYRDLIQHIQNLTNKQKI
                    ************************************************************

    COL             MSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSL
    N315            MSSDKTIRDVFGYCVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSL
    NCTC8325        MSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSL
    Newman          MSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSL
    USA300_FPR3757  MSSDKTIRDVFGYSVDKGWMCIQVFFIRQGNMIKRDTTMIPLQQTEEEEFYTFIGQFYSL
                    *************.**********************************************

    COL             NQHILPKEVHVPRNLDKEMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISR
    N315            NQHILPKEVHVPRNLDKEMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISR
    NCTC8325        NQHILPKEVHVPRNLDKEMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISR
    Newman          NQHILPKEVHVPRNLDKEMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISR
    USA300_FPR3757  NQHILPKEVHVPRNLDKEMIQSVVDTKIVQPARGPKKDMVDLAAHNAKVSLNNKFELISR
                    ************************************************************

    COL             DESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIK
    N315            DESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIK
    NCTC8325        DESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIK
    Newman          DESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIK
    USA300_FPR3757  DESRTIKAIEELGTQMGIQTPIRIEAFDNSNIQGVDPVSAMVTFVDGKPDKKNYRKYKIK
                    ************************************************************

    COL             TVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQNELGLDIPVA
    N315            TVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQNELGLDIPVA
    NCTC8325        TVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQNELGLDIPVA
    Newman          TVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQNELGLDIPVA
    USA300_FPR3757  TVKGPDDYKSMREVVRRRYSRVLNEGLPLPDLIIVDGGKGHMNGVIDVLQNELGLDIPVA
                    ************************************************************

    COL             GLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKS
    N315            GLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKS
    NCTC8325        GLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKS
    Newman          GLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKS
    USA300_FPR3757  GLQKNDKHQTSELLYGASAEIVPLKKNSQAFYLLHRIQDEVHRFAITFHRQTRQKTGLKS
                    ************************************************************

    COL             ILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHEQLHK
    N315            ILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHEQLHK
    NCTC8325        ILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHEQLHK
    Newman          ILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHEQLHK
    USA300_FPR3757  ILDDIDGIGNKRKTLLLRSFGSIKKMKEATLEDFKNIGIPENVAKNLHEQLHK
                    *****************************************************