From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003398000
  • symbol?: flr
  • description?: formyl peptide receptor-like 1 inhibitory protein

      descriptions from strain specific annotations:

    • formyl peptide receptor-like 1 inhibitory protein
    • FPRL1 inhibitory protein
    • FPRL1 inhibitory protein (FLIPr)
    • formyl peptide receptor family 1 inhibitory protein
    • FPRL1 inhibitory protein FLIPr
    • pseudogene
  • strand?: -
  • coordinates?: 3756037..3756442
  • synteny block?: BlockID0024810
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1112
    08BA02176:
    C248_1184
    11819-97:
    MS7_1112 (flr)
    71193:
    ST398NM01_1151
    ECT-R 2:
    ECTR2_1010
    ED133:
    ED98:
    SAAV_1124
    HO 5096 0412:
    SAEMRSA15_09850
    JH1:
    SaurJH1_1237
    JH9:
    SaurJH9_1213
    JKD6008:
    SAA6008_01109 (flr)
    JKD6159:
    SAA6159_01008 (flr)
    LGA251:
    SARLGA251_10660 (flr)
    M013:
    M013TW_1088
    MRSA252:
    SAR1128
    MSHR1132:
    SAMSHR1132_10000
    MSSA476:
    SAS1089
    Mu3:
    SAHV_1146
    Mu50:
    SAV1156
    MW2:
    MW1038
    RF122:
    SAB1019c
    ST398:
    SAPIG1151
    T0131:
    SAT0131_01199
    TCH60:
    TW20:
    SATW20_11480 (flr)
    USA300_TCH1516:
    USA300HOU_1092
    VC40:
    SAVC_04935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKE
    N315            MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKE
    NCTC8325        MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKE
    Newman          MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKE
    USA300_FPR3757  MKKNITKTIIASTVIAAGLLTQTNDAKAFFSYEWKGLEIAKNLADQAKKDDERIDKLMKE
                    ************************************************************

    COL             SDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIK
    N315            SDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIK
    NCTC8325        SDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIK
    Newman          SDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDDGPRDYYTFDLTRPLEENRKNIK
    USA300_FPR3757  SDKNLTPYKAETVNDLYLIVKKLSQGDVKKAVVRIKDGGPRDYYTFDLTRPLEENRKNIK
                    *************************************.**********************

    COL             VVKNGEIDSITWY
    N315            VVKNGEIDSIYWD
    NCTC8325        VVKNGEIDSITWY
    Newman          VVKNGEIDSITWY
    USA300_FPR3757  VVKNGEIDSITWY
                    ********** *