From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003426000
  • symbol?: ssl12
  • description?: staphylococcal superantigen-like protein 12

      descriptions from strain specific annotations:

    • staphylococcal superantigen-like protein 12
    • superantigen-like protein
    • exotoxin
    • staphylococcal/Streptococcal toxin, beta-grasp domain protein
  • strand?: -
  • coordinates?: 3775445..3776161
  • synteny block?: BlockID0025070
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1122
    08BA02176:
    C248_1192
    11819-97:
    MS7_1121
    71193:
    ST398NM01_1160
    ECT-R 2:
    ECTR2_1020
    ED133:
    SAOV_1164c
    ED98:
    SAAV_1134
    HO 5096 0412:
    SAEMRSA15_09970
    JH1:
    SaurJH1_1249
    JH9:
    SaurJH9_1224
    JKD6008:
    SAA6008_01118
    JKD6159:
    SAA6159_01016
    LGA251:
    SARLGA251_10750
    M013:
    M013TW_1097
    MRSA252:
    SAR1139
    MSHR1132:
    SAMSHR1132_10070
    MSSA476:
    SAS1099
    Mu3:
    SAHV_1156
    Mu50:
    SAV1166
    MW2:
    MW1047
    RF122:
    SAB1030c
    ST398:
    SAPIG1160
    T0131:
    SAT0131_01209
    TCH60:
    HMPREF0772_12068
    TW20:
    SATW20_11580
    USA300_TCH1516:
    USA300HOU_1103
    VC40:
    SAVC_04980

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
    N315            MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
    NCTC8325        MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
    Newman          MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
    USA300_FPR3757  MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHF
                    ************************************************************

    COL             SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
    N315            SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
    NCTC8325        SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
    Newman          SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
    USA300_FPR3757  SFSNKWLYQYDNGNIYVELKRYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQL
                    ************************************************************

    COL             WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
    N315            WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
    NCTC8325        WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
    Newman          WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
    USA300_FPR3757  WWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAHKIYQGNKPVLTLKEIDFRAR
                    ************************************************************

    COL             EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
    N315            EALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
    NCTC8325        EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
    Newman          EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
    USA300_FPR3757  EALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD
                    **********.***********************************************