From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003430000
  • symbol?: arcC1
  • description?: carbamate kinase

      descriptions from strain specific annotations:

    • carbamate kinase
    • putative amino acid kinase
    • putative carbamate kinase
    • carbamate kinase, ArcC1
    • Carbamate kinase 1
  • strand?: +
  • coordinates?: 3781725..3782666
  • synteny block?: BlockID0025110
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1182 (arcC1)
    N315:
    NCTC8325:
    Newman:
    NWMN_1079 (arcC)
    USA300_FPR3757:
    04-02981:
    SA2981_1126
    08BA02176:
    C248_1196
    11819-97:
    MS7_1125
    71193:
    ST398NM01_1164
    ECT-R 2:
    ECTR2_1024 (arcC)
    ED133:
    SAOV_1168
    ED98:
    SAAV_1138 (arcC1)
    HO 5096 0412:
    SAEMRSA15_10010
    JH1:
    SaurJH1_1253
    JH9:
    SaurJH9_1228
    JKD6008:
    SAA6008_01122 (arcC1)
    JKD6159:
    SAA6159_01020 (arcC1)
    LGA251:
    SARLGA251_10790
    M013:
    M013TW_1101
    MRSA252:
    SAR1143
    MSHR1132:
    SAMSHR1132_10110
    MSSA476:
    SAS1103
    Mu3:
    SAHV_1160
    Mu50:
    SAV1170
    MW2:
    MW1051
    RF122:
    SAB1034
    ST398:
    SAPIG1164 (arcC)
    T0131:
    SAT0131_01214 (rpsH)
    TCH60:
    HMPREF0772_12064 (arcC2)
    TW20:
    SATW20_11620
    USA300_TCH1516:
    USA300HOU_1107 (arcC2)
    VC40:
    SAVC_05000

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKIVVALGGNALGKSPQEQLELVKNTAKSLVGLITKGHEIVISHGNGPQVGSINLGLNY
    N315            MAKIVVALGGNALGKSPQEQLELVKNTAKSLVGLITKGHEIVISHGNGPQVGSINLGLNY
    NCTC8325        MAKIVVALGGNALGKSPQEQLELVKNTAKSLVGLITKGHEIVISHGNGPQVGSINLGLNY
    Newman          MAKIVVALGGNALGKSPQEQLELVKNTAKSLVGLITKGHEIVISHGNGPQVGSINLGLNY
    USA300_FPR3757  MAKIVVALGGNALGKSPQEQLELVKNTAKSLVGLITKGHEIVISHGNGPQVGSINLGLNY
                    ************************************************************

    COL             AAEHNQGPAFPFAECGAMSQAYIGYQLQESLQNELHSIGMDKQVVTLVTQVEVDENDPAF
    N315            AAEHNQGPAFPFAECGAMSQAYIGYQLQESLQNELHSIGMDKQVVTLVTQVEVDENDPAF
    NCTC8325        AAEHNQGPAFPFAECGAMSQAYIGYQLQESLQNELHSIGMDKQVVTLVTQVEVDENDPAF
    Newman          AAEHNQGPAFPFAECGAMSQAYIGYQLQESLQNELHSIGMDKQVVTLVTQVEVDENDPAF
    USA300_FPR3757  AAEHNQGPAFPFAECGAMSQAYIGYQLQESLQNELHSIGMDKQVVTLVTQVEVDENDPAF
                    ************************************************************

    COL             NNPSKPIGLFYNKEEAEQIQKEKGFIFVEDAGRGYRRVVPSPQPISIIELESIKTLIKND
    N315            NNPSKPIGLFYNKEEAEQIQKEKGFIFVEDAGRGYRRVVPSPQPISIIELESIKTLIKND
    NCTC8325        NNPSKPIGLFYNKEEAEQIQKEKGFIFVEDAGRGYRRVVPSPQPISIIELESIKTLIKND
    Newman          NNPSKPIGLFYNKEEAEQIQKEKGFIFVEDAGRGYRRVVPSPQPISIIELESIKTLIKND
    USA300_FPR3757  NNPSKPIGLFYNKEEAEQIQKEKGFIFVEDAGRGYRRVVPSPQPISIIELESIKTLIKND
                    ************************************************************

    COL             TLVIAAGGGGIPVIREQHDGFKGIDAVIDKDKTSALLGANIQCDQLIILTAIDYVYINFN
    N315            TLVIAAGGGGIPVIREQHDGFKGIDAVIDKDKTSALLGANIQCDQLIILTAIDYVYINFN
    NCTC8325        TLVIAAGGGGIPVIREQHDGFKGIDAVIDKDKTSALLGANIQCDQLIILTAIDYVYINFN
    Newman          TLVIAAGGGGIPVIREQHDGFKGIDAVIDKDKTSALLGANIQCDQLIILTAIDYVYINFN
    USA300_FPR3757  TLVIAAGGGGIPVIREQHDGFKGIDAVIDKDKTSALLGANIQCDQLIILTAIDYVYINFN
                    ************************************************************

    COL             TENQQPLKTTNVDELKRYIDENQFAKGSMLPKIEAAISFIENNPKGSVLITSLNELDAAL
    N315            TENQQPLKTTNVDELKRYIDENQFAKGSMLPKIEAAISFIENNPKGSVLITSLNELDAAL
    NCTC8325        TENQQPLKTTNVDELKRYIDENQFAKGSMLPKIEAAISFIENNPKGSVLITSLNELDAAL
    Newman          TENQQPLKTTNVDELKRYIDENQFAKGSMLPKIEAAISFIENNPKGSVLITSLNELDAAL
    USA300_FPR3757  TENQQPLKTTNVDELKRYIDENQFAKGSMLPKIEAAISFIENNPKGSVLITSLNELDAAL
                    ************************************************************

    COL             EGKVGTVIKK
    N315            EGKVGTVIKK
    NCTC8325        EGKVGTVIKK
    Newman          EGKVGTVIKK
    USA300_FPR3757  EGKVGTVIKK
                    **********