From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003451000
  • symbol?: pbp1
  • description?: penicillin-binding protein 1

      descriptions from strain specific annotations:

    • penicillin-binding protein 1
    • penicillin-binding protein
    • cell division protein FtsI
    • Cell division protein FtsI (Peptidoglycan synthetase)
    • penicillin-binding protein 2B (PBP-2B)
    • penicillin binding transpeptidase domain protein
  • strand?: +
  • coordinates?: 3793808..3796042
  • synteny block?: BlockID0025310
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1194 (pbp1)
    N315:
    SA1024 (pbpA)
    NCTC8325:
    Newman:
    NWMN_1091 (pbpA)
    USA300_FPR3757:
    04-02981:
    SA2981_1139 (ftsI)
    08BA02176:
    C248_1210 (pbpA)
    11819-97:
    MS7_1138
    71193:
    ST398NM01_1178
    ECT-R 2:
    ECTR2_1037
    ED133:
    SAOV_1182
    ED98:
    SAAV_1152 (pbp1)
    HO 5096 0412:
    SAEMRSA15_10140 (pbpA)
    JH1:
    SaurJH1_1265
    JH9:
    SaurJH9_1240
    JKD6008:
    SAA6008_01135 (pbpA)
    JKD6159:
    SAA6159_01032 (pbpA)
    LGA251:
    SARLGA251_10920 (pbpA)
    M013:
    M013TW_1115
    MRSA252:
    SAR1157 (pbpA)
    MSHR1132:
    SAMSHR1132_10230
    MSSA476:
    SAS1115
    Mu3:
    SAHV_1171 (pbpA)
    Mu50:
    SAV1181 (pbpA)
    MW2:
    MW1064 (pbpA)
    RF122:
    SAB1045 (pbpA)
    ST398:
    SAPIG1178
    T0131:
    SAT0131_01226 (rpsS)
    TCH60:
    HMPREF0772_12051 (pbp1)
    TW20:
    SATW20_11750 (pbpA)
    USA300_TCH1516:
    USA300HOU_1121 (pbpA)
    VC40:
    SAVC_05070

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKQKIKIKKNKIGAVLLVGLFGLLFFILVLRISYIMITGHSNGQDLVMKANEKYLVKNA
    N315            MAKQKIKIKKNKIGAVLLVGLFGLLFFILVLRISYIMITGHSNGQDLVMKANEKYLVKNA
    NCTC8325        MAKQKIKIKKNKIGAVLLVGLFGLLFFILVLRISYIMITGHSNGQDLVMKANEKYLVKNA
    Newman          MAKQKIKIKKNKIGAVLLVGLFGLLFFILVLRISYIMITGHSNGQDLVMKANEKYLVKNA
    USA300_FPR3757  MAKQKIKIKKNKIGAVLLVGLFGLLFFILVLRISYIMITGHSNGQDLVMKANEKYLVKNA
                    ************************************************************

    COL             QQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASANSKKPRHVVDKKETAKKLSTVINMK
    N315            QQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASANSKKPRHVVDKKETAKKLSTVIDMK
    NCTC8325        QQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASANSKKPRHVVDKKETAKKLSTVINMK
    Newman          QQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASANSKKPRHVVDKKETAKKLSTVINMK
    USA300_FPR3757  QQPERGKIYDRNGKVLAEDVERYKLVAVIDKKASANSKKPRHVVDKKETAKKLSTVINMK
                    *********************************************************:**

    COL             PEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKMNLPGISLLPETERFYPNGNFASHL
    N315            PEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKMNLPGISLLPETERFYPNGNFASHL
    NCTC8325        PEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKMNLPGISLLPETERFYPNGNFASHL
    Newman          PEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKMNLPGISLLPETERFYPNGNFASHL
    USA300_FPR3757  PEEIEKRLSQKKAFQIEFGRKGTNLTYQDKLKIEKMNLPGISLLPETERFYPNGNFASHL
                    ************************************************************

    COL             IGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRYIHDIWGYIAPNTKKEKQPKRGDDV
    N315            IGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRYIHDIWGYIAPNTKKEKQPKRGDDV
    NCTC8325        IGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRYIHDIWGYIAPNTKKEKQPKRGDDV
    Newman          IGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRYIHDIWGYIAPNTKKEKQPKRGDDV
    USA300_FPR3757  IGRAQKNPDTGELKGALGVEKIFDSYLSGSKGSLRYIHDIWGYIAPNTKKEKQPKRGDDV
                    ************************************************************

    COL             HLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
    N315            HLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
    NCTC8325        HLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
    Newman          HLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
    USA300_FPR3757  HLTIDSNIQVFVEEALDGMVERYQPKDLFAVVMDAKTGEILAYSQRPTFNPETGKDFGKK
                    ************************************************************

    COL             WANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRISDWNRVGWGEIP
    N315            WANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRISDWNRVGWGEIP
    NCTC8325        WANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRISDWNRVGWGEIP
    Newman          WANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRISDWNRVGWGEIP
    USA300_FPR3757  WANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRISDWNRVGWGEIP
                    ************************************************************

    COL             MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKSTKGMFDGEAPGQIGWSNELQQKT
    N315            MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKSTKGMFDGEAPGQIGWSNELQQKT
    NCTC8325        MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKSTKGMFDGEAPGQIGWSNELQQKT
    Newman          MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKSTKGMFDGEAPGQIGWSNELQQKT
    USA300_FPR3757  MSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFGKSTKGMFDGEAPGQIGWSNELQQKT
                    ************************************************************

    COL             SSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKRQFYKGQKQIAGKPITKD
    N315            SSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKRQFYKGQKQIAGKPITKD
    NCTC8325        SSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKRQFYKGQKQIAGKPITKD
    Newman          SSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKRQFYKGQKQIAGKPITKD
    USA300_FPR3757  SSFGQSTTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKRQFYKGQKQIAGKPITKD
                    ************************************************************

    COL             TAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKGPNPYFVSFMG
    N315            TAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKGPNPYFVSFMG
    NCTC8325        TAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKGPNPYFVSFMG
    Newman          TAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKGPNPYFVSFMG
    USA300_FPR3757  TAEKVEKQLDLVVNSKKSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKGPNPYFVSFMG
                    ************************************************************

    COL             DAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLKYLNVGKSKDDTSNAEYS
    N315            DAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLKYLNVGKSKDDTSNAEYS
    NCTC8325        DAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLKYLNVGKSKDDTSNAEYS
    Newman          DAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLKYLNVGKSKDDTSNAEYS
    USA300_FPR3757  DAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLKYLNVGKSKDDTSNAEYS
                    ************************************************************

    COL             KVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQSIKAGNKVLPHSKVLLLTDGDLTM
    N315            KVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQSIKAGNKVLPHSKVLLLTDGDLTM
    NCTC8325        KVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQSIKAGNKVLPHSKVLLLTDGDLTM
    Newman          KVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQSIKAGNKVLPHSKVLLLTDGDLTM
    USA300_FPR3757  KVPDVEGQDKQKAIDNVSAKSLEPVTIGSGTQIKAQSIKAGNKVLPHSKVLLLTDGDLTM
                    ************************************************************

    COL             PDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSISKGQKLTEKDKIDVEFSSENVDSNS
    N315            PDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSISKGQKLTEKDKIDVEFSSENVDSNS
    NCTC8325        PDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSISKGQKLTEKDKIDVEFSSENVDSNS
    Newman          PDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSISKGQKLTEKDKIDVEFSSENVDSNS
    USA300_FPR3757  PDMSGWTKEDVIAFENLTNIKVNLKGSGFVSHQSISKGQKLTEKDKIDVEFSSENVDSNS
                    ************************************************************

    COL             TNNSDSNSDDKKKSDSKTDKDKSD
    N315            TNNSDSNSDDKKKSDSKTDKDKSD
    NCTC8325        TNNSDSNSDDKKKSDSKTDKDKSD
    Newman          TNNSDSNSDDKKKSDSKTDKDKSD
    USA300_FPR3757  TNNSDSNSDDKKKSDSKTDKDKSD
                    ************************