From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003454000
  • symbol?: divIB
  • description?: cell division protein

      descriptions from strain specific annotations:

    • cell division protein
    • cell division protein FtsQ
    • cell division protein FtsQ family protein
    • putative cell division protein
    • POTRA domain, FtsQ-type family protein
  • strand?: +
  • coordinates?: 3798663..3800017
  • synteny block?: BlockID0025340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1197 (divIB)
    N315:
    SA1027 (div1b)
    NCTC8325:
    Newman:
    NWMN_1094 (ftsQ)
    USA300_FPR3757:
    SAUSA300_1078 (divIB)
    04-02981:
    SA2981_1142 (ftsQ)
    08BA02176:
    C248_1213
    11819-97:
    MS7_1141
    71193:
    ST398NM01_1181
    ECT-R 2:
    ECTR2_1040
    ED133:
    SAOV_1185
    ED98:
    SAAV_1155 (divIB)
    HO 5096 0412:
    SAEMRSA15_10170
    JH1:
    SaurJH1_1268
    JH9:
    SaurJH9_1243
    JKD6008:
    SAA6008_01138 (div1b)
    JKD6159:
    SAA6159_01035 (div1b)
    LGA251:
    SARLGA251_10950
    M013:
    M013TW_1118
    MRSA252:
    SAR1160
    MSHR1132:
    SAMSHR1132_10260
    MSSA476:
    SAS1118
    Mu3:
    SAHV_1174 (div1b)
    Mu50:
    SAV1184 (div1b)
    MW2:
    MW1067 (div1b)
    RF122:
    SAB1048
    ST398:
    SAPIG1181
    T0131:
    SAT0131_01229 (rplD)
    TCH60:
    HMPREF0772_12048 (divIB)
    TW20:
    SATW20_11780
    USA300_TCH1516:
    USA300HOU_1124 (ftsQ)
    VC40:
    SAVC_05085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MDDKTKNDQQESNEDKDELELFTRNTSKKRRQRKRSKATHFSNQNKDDTSQQADFDEEI
    N315            -MDDKTKNDQQESNEDKDELELFTRNTSKKRRQRKRSKATHFSNQNKDDTSQQADFDEEI
    NCTC8325        -MDDKTKNDQQESNEDKDELELFTRNTSKKRRQRKRSKATHFSNQNKDDTSQQADFDEEI
    Newman          MMDDKTKNDQQESNEDKDELELFTRNTSKKRRQRKRSKATHFSNQNKDDTSQQADFDEEI
    USA300_FPR3757  -MDDKTKNDQQESNEDKDELELFTRNTSKKRRQRKRSKATHFSNQNKDDTSQQADFDEEI
                     ***********************************************************

    COL             YLINKDFKKEESNDKNNDSASSHANDNNIDDSTDSNIENEDYRYNQEIDDQNESNVISVD
    N315            YLINKDFKKEESNDENNGSASSHANDNNIDDSTDSNIENEDYRYNQEIDDQNESNGIAVG
    NCTC8325        YLINKDFKKEESNDKNNDSASSHANDNNIDDSTDSNIENEDYRYNQEIDDQNESNVISVD
    Newman          YLINKDFKKEESNDKNNDSASSHANDNNIDDSTDSNIENEDYRYNQEIDDQNESNVISVD
    USA300_FPR3757  YLINKDFKKEESNDKNNDSASSHANDNNIDDSTDSNIENEDYRYNQEIDDQNESNVISVD
                    **************:**.************************************* *:*.

    COL             NEQPQSAPKEQNSDSIDEETVTKKERKSKVTQLKPLTLEEKRKLRRKRQKRIQYSVITIL
    N315            NEQPQSAPKEQNSDSNDEETVTKKERKSKVTQLKPLTLEEKRKLRRKRQKRIQYSVITIL
    NCTC8325        NEQPQSAPKEQNSDSIDEETVTKKERKSKVTQLKPLTLEEKRKLRRKRQKRIQYSVITIL
    Newman          NEQPQSAPKEQNSDSIDEETVTKKERKSKVTQLKPLTLEEKRKLRRKRQKRIQYSVITIL
    USA300_FPR3757  NEQPQSAPKEQNSDSIDEETVTKKERKSKVTQLKPLTLEEKRKLRRKRQKRIQYSVITIL
                    *************** ********************************************

    COL             VLLIAVILIYMFSPLSKIAHVNINGNNHVSTSKINKVLGVKNDSRMYTFSKKNAINDLEE
    N315            VLLIAVILIYMFSPLSKIAHVNINGNNHVSTSKINKVLGVKNDSRMYTFSKKNAINDLEE
    NCTC8325        VLLIAVILIYMFSPLSKIAHVNINGNNHVSTSKINKVLGVKNDSRMYTFSKKNAINDLEE
    Newman          VLLIAVILIYMFSPLSKIAHVNINGNNHVSTSKINKVLGVKNDSRMYTFSKKNAINDLEE
    USA300_FPR3757  VLLIAVILIYMFSPLSKIAHVNINGNNHVSTSKINKVLGVKNDSRMYTFSKKNAINDLEE
                    ************************************************************

    COL             NPLIKSVEIHKQLPNTLNVDITENEIIALVKYKGKYLPLLENGKLLKGSNDVKINDAPVM
    N315            DPLIKSVEIHKQLPNTLNVDITENEIIALVKYKGKYLPLLENGKLLKGSNDVKINDAPVM
    NCTC8325        NPLIKSVEIHKQLPNTLNVDITENEIIALVKYKGKYLPLLENGKLLKGSNDVKINDAPVM
    Newman          NPLIKSVEIHKQLPNTLNVDITENEIIALVKYKGKYLPLLENGKLLKGSNDVKINDAPVM
    USA300_FPR3757  NPLIKSVEIHKQLPNTLNVDITENEIIALVKYKGKYLPLLENGKLLKGSNDVKINDAPVM
                    :***********************************************************

    COL             DGFKGTKEDDMIKALSEMTPEVRRYIAEVTYAPSKNKQSRIELFTTDGLQVIGDISTISK
    N315            DGFKGTKEDDMIKALSEMTPEVRRYIAEVTYAPSKNKQSRIELFTTDGLQVIGDISTISK
    NCTC8325        DGFKGTKEDDMIKALSEMTPEVRRYIAEVTYAPSKNKQSRIELFTTDGLQVIGDISTISK
    Newman          DGFKGTKEDDMIKALSEMTPEVRRYIAEVTYAPSKNKQSRIELFTTDGLQVIGDISTISK
    USA300_FPR3757  DGFKGTKEDDMIKALSEMTPEVRRYIAEVTYAPSKNKQSRIELFTTDGLQVIGDISTISK
                    ************************************************************

    COL             KMKYYPQMSQSLSRDSSGKLKTRGYIDLSVGASFIPYRGNTSSQSESDKNVTKSSQEENQ
    N315            KMKYYPQMSQSLSRDSSGKLKTRGYIDLSVGASFIPYRGNTSSQSESDKNVTKSSQEENQ
    NCTC8325        KMKYYPQMSQSLSRDSSGKLKTRGYIDLSVGASFIPYRGNTSSQSESDKNVTKSSQEENQ
    Newman          KMKYYPQMSQSLSRDSSGKLKTRGYIDLSVGASFIPYRGNTSSQSESDKNVTKSSQEENQ
    USA300_FPR3757  KMKYYPQMSQSLSRDSSGKLKTRGYIDLSVGASFIPYRGNTSSQSESDKNVTKSSQEENQ
                    ************************************************************

    COL             AKEELQSVLNKINKQSSKNN
    N315            AKEELQSVLNKINKQSSKNN
    NCTC8325        AKEELQSVLNKINKQSSKNN
    Newman          AKEELQSVLNKINKQSSKNN
    USA300_FPR3757  AKEELQSVLNKINKQSSKNN
                    ********************