From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003455000
  • symbol?: ftsA
  • description?: cell division protein FtsA

      descriptions from strain specific annotations:

    • cell division protein FtsA
    • cell division protein
    • putative cell division protein
  • strand?: +
  • coordinates?: 3800123..3801535
  • synteny block?: BlockID0025350
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1198 (ftsA)
    N315:
    SA1028 (ftsA)
    NCTC8325:
    Newman:
    NWMN_1095 (ftsA)
    USA300_FPR3757:
    04-02981:
    SA2981_1143 (ftsA)
    08BA02176:
    C248_1214 (ftsA)
    11819-97:
    MS7_1142 (ftsA)
    71193:
    ST398NM01_1182
    ECT-R 2:
    ECTR2_1041 (ftsA)
    ED133:
    SAOV_1186 (ftsA)
    ED98:
    SAAV_1156 (ftsA)
    HO 5096 0412:
    SAEMRSA15_10180 (ftsA)
    JH1:
    SaurJH1_1269
    JH9:
    SaurJH9_1244
    JKD6008:
    SAA6008_01139 (ftsA)
    JKD6159:
    SAA6159_01036 (ftsA)
    LGA251:
    SARLGA251_10960 (ftsA)
    M013:
    M013TW_1119
    MRSA252:
    SAR1161 (ftsA)
    MSHR1132:
    SAMSHR1132_10270
    MSSA476:
    SAS1119
    Mu3:
    SAHV_1175 (ftsA)
    Mu50:
    SAV1185 (ftsA)
    MW2:
    MW1068 (ftsA)
    RF122:
    SAB1049 (ftsA)
    ST398:
    SAPIG1182 (ftsA)
    T0131:
    SAT0131_01230 (rplC)
    TCH60:
    HMPREF0772_12047 (ftsA)
    TW20:
    SATW20_11790 (ftsA)
    USA300_TCH1516:
    VC40:
    SAVC_05090

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTI
    N315            MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTI
    NCTC8325        MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTI
    Newman          MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTI
    USA300_FPR3757  MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTI
                    ************************************************************

    COL             KKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQE
    N315            KKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQE
    NCTC8325        KKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQE
    Newman          KKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQE
    USA300_FPR3757  KKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQE
                    ************************************************************

    COL             TEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVL
    N315            TEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVL
    NCTC8325        TEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVL
    Newman          TEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVL
    USA300_FPR3757  TEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVL
                    ************************************************************

    COL             DVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIA
    N315            DVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIA
    NCTC8325        DVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIA
    Newman          DVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIA
    USA300_FPR3757  DVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIA
                    ************************************************************

    COL             QGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEI
    N315            QGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEI
    NCTC8325        QGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEI
    Newman          QGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEI
    USA300_FPR3757  QGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEI
                    ************************************************************

    COL             FFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFS
    N315            FFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFS
    NCTC8325        FFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFS
    Newman          FFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFS
    USA300_FPR3757  FFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFS
                    ************************************************************

    COL             SAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDT
    N315            SAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDT
    NCTC8325        SAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDT
    Newman          SAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDT
    USA300_FPR3757  SAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDT
                    ************************************************************

    COL             HENEVESTDEEIYQSEDNHQEHKQNHEHVQDKDKDKEESKFKKLMKSLFE
    N315            HENEVESTDEEIYQSEDNHQEHKQNHEHVQDKDKDKEESKFKKLMKSLFE
    NCTC8325        HENEVESTDEEIYQSEDNHQEHKQNHEHVQDKDKDKEESKFKKLMKSLFE
    Newman          HENEVESTDEEIYQSEDNHQEHKQNHEHVQDKDKDKEESKFKKLMKSLFE
    USA300_FPR3757  HENEVESTDEEIYQSEDNHQEHKQNHEHVQDKDKDKEESKFKKLMKSLFE
                    **************************************************