From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003459000
  • symbol?:
  • description?: YggS family pyridoxal phosphate enzyme

      descriptions from strain specific annotations:

    • YggS family pyridoxal phosphate enzyme
    • alanine racemase domain-containing protein
    • enzyme with a TIM-barrel fold
    • protein YlmE
    • Pyridoxal-5'-phosphate family protein
  • strand?: +
  • coordinates?: 3803827..3804528
  • synteny block?: BlockID0025390
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1146
    08BA02176:
    C248_1217
    11819-97:
    MS7_1145
    71193:
    ST398NM01_1186
    ECT-R 2:
    ECTR2_1044
    ED133:
    SAOV_1189
    ED98:
    SAAV_1159
    HO 5096 0412:
    SAEMRSA15_10210
    JH1:
    SaurJH1_1272
    JH9:
    SaurJH9_1247
    JKD6008:
    SAA6008_01142
    JKD6159:
    SAA6159_01039
    LGA251:
    SARLGA251_10990
    M013:
    M013TW_1122
    MRSA252:
    SAR1164
    MSHR1132:
    SAMSHR1132_10300
    MSSA476:
    SAS1122
    Mu3:
    SAHV_1178
    Mu50:
    SAV1188
    MW2:
    MW1071
    RF122:
    SAB1052
    ST398:
    SAPIG1186
    T0131:
    SAT0131_01235
    TCH60:
    HMPREF0772_12044 (ylmE)
    TW20:
    SATW20_11820
    USA300_TCH1516:
    USA300HOU_1125
    VC40:
    SAVC_05105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRVKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGF
    N315            MRVKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGF
    NCTC8325        --MKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGF
    Newman          MRVKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGF
    USA300_FPR3757  --MKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGF
                      :*********************************************************

    COL             FQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQV
    N315            FQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQV
    NCTC8325        FQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQV
    Newman          FQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQV
    USA300_FPR3757  FQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQV
                    ************************************************************

    COL             NVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEE
    N315            NVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEE
    NCTC8325        NVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEE
    Newman          NVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEE
    USA300_FPR3757  NVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEE
                    ************************************************************

    COL             IQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE
    N315            IQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE
    NCTC8325        IQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE
    Newman          IQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE
    USA300_FPR3757  IQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE
                    ********************************************