From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1082 [new locus tag: SAUSA300_RS05865 ]
  • pan locus tag?: SAUPAN003459000
  • symbol: SAUSA300_1082
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1082 [new locus tag: SAUSA300_RS05865 ]
  • symbol: SAUSA300_1082
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1183796..1184464
  • length: 669
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    GTGAAAGATAATTTACAACAAATCTCAACACAAATTAATGACAAAAGTGAAAAAAATAAT
    TTTTCAACAAAACCAAACGTGATTGCAGTTACAAAATATGTTACAATAGAGCGAGCTAAA
    GAAGCGTATGAGGCTGGAATAAGACATTTTGGTGAGAATAGATTGGAAGGCTTTTTTCAA
    AAGAAAGAAGCATTACCATCAGATGCGGTGATCCATTTTATAGGATCATTACAATCTCGA
    AAAGTTAAGGACGTTATAAACGACGTAGATTATTTCCATGCTTTAGATCGATTGAGCTTA
    GCCAAAGAAATTAACAAACGTGCAGAACATAAAATTAAATGTTTCTTGCAAGTGAACGTT
    TCGGGAGAAGCTTCTAAACATGGTATTGCTTTAGAAGATGTTGATCAGTTTATAGATGAT
    CTTAAAAAATATGACAAAATCGAAATTGTAGGTTTAATGACGATGGCACCATTGACAGAT
    GATGAAGCATATATTAGATCGTTATTTAAACAGTTACGTTTGAAAAAAGAAGAAATACAA
    CGACTCAATTTAGAATATGCGCCTTGTGATGAATTATCAATGGGAATGAGTAATGACTAT
    CTTATTGCAGTTGAAGAAGGTGCGACGTTTGTTAGAATTGGGACTAAACTTGTAGGAGAA
    GAGGAGTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    669

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1082 [new locus tag: SAUSA300_RS05865 ]
  • symbol: SAUSA300_1082
  • description: hypothetical protein
  • length: 222
  • theoretical pI: 5.44524
  • theoretical MW: 25346.8
  • GRAVY: -0.440541

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Unknown functionEnzymes of unknown specificitypyridoxal phosphate enzyme, YggS family (TIGR00044; HMM-score: 157.7)
  • TheSEED:  
    A Hypothetical Protein Related to Proline Metabolism UPF0001 protein YggS 
    Cell Division Cluster UPF0001 protein YggS 
  • PFAM:
    TIM_barrel (CL0036) Ala_racemase_N; Alanine racemase, N-terminal domain (PF01168; HMM-score: 74.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:
    SAUSA300_0594(adh)alcohol dehydrogenase  [1] (data from MRSA252)
    SAUSA300_0533(tuf)elongation factor Tu  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 18
    • Cmax: 0.122
    • Cmax_pos: 30
    • Smax: 0.265
    • Smax_pos: 12
    • Smean: 0.193
    • D: 0.165
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKDNLQQISTQINDKSEKNNFSTKPNVIAVTKYVTIERAKEAYEAGIRHFGENRLEGFFQKKEALPSDAVIHFIGSLQSRKVKDVINDVDYFHALDRLSLAKEINKRAEHKIKCFLQVNVSGEASKHGIALEDVDQFIDDLKKYDKIEIVGLMTMAPLTDDEAYIRSLFKQLRLKKEEIQRLNLEYAPCDELSMGMSNDYLIAVEEGATFVRIGTKLVGEEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]