From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003460000
  • symbol?: sepF
  • description?: cell division protein SepF

      descriptions from strain specific annotations:

    • cell division protein SepF
    • cell division-like FtsZ-interacting protein
    • YlmF
  • strand?: +
  • coordinates?: 3804525..3805088
  • synteny block?: BlockID0025400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1202 (ylmF)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1147
    08BA02176:
    C248_1218
    11819-97:
    MS7_1146 (sepF)
    71193:
    ST398NM01_1187
    ECT-R 2:
    ECTR2_1045
    ED133:
    SAOV_1190
    ED98:
    SAAV_1160
    HO 5096 0412:
    SAEMRSA15_10220
    JH1:
    SaurJH1_1273
    JH9:
    SaurJH9_1248
    JKD6008:
    SAA6008_01143 (sepF)
    JKD6159:
    SAA6159_01040 (sepF)
    LGA251:
    SARLGA251_11000 (sepF)
    M013:
    M013TW_1123
    MRSA252:
    SAR1165
    MSHR1132:
    SAMSHR1132_10310
    MSSA476:
    SAS1123
    Mu3:
    SAHV_1179
    Mu50:
    SAV1189
    MW2:
    MW1072
    RF122:
    SAB1053
    ST398:
    SAPIG1187
    T0131:
    SAT0131_01236 (topB)
    TCH60:
    HMPREF0772_12043 (ylmF)
    TW20:
    SATW20_11830 (sepF)
    USA300_TCH1516:
    USA300HOU_1126
    VC40:
    SAVC_05110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRY
    N315            MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRY
    NCTC8325        MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRY
    Newman          MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRY
    USA300_FPR3757  MSHLALKDLFSGFFVIDDEEEVEVPDKQQQVNEAPAKEQSQQTTKQNAIKSVPQKSASRY
                    ************************************************************

    COL             TTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKN
    N315            TTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKN
    NCTC8325        TTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKN
    Newman          TTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKN
    USA300_FPR3757  TTTSEERNNRMSNYSKNNSRNVVTMNNATPNNASQESSKMCLFEPRVFSDTQDIADELKN
                    ************************************************************

    COL             RRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIE
    N315            RRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIE
    NCTC8325        RRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIE
    Newman          RRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIE
    USA300_FPR3757  RRATLVNLQRIDKVSAKRIIDFLSGTVYAIGGDIQRVGTDIFLCTPDNVEVAGSITDHIE
                    ************************************************************

    COL             NMEHSFD
    N315            NMEHSFD
    NCTC8325        NMEHSFD
    Newman          NMEHSFD
    USA300_FPR3757  NMEHSFD
                    *******