From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003491000
  • symbol?: gmk
  • description?: guanylate kinase
  • strand?: +
  • coordinates?: 3831108..3831731
  • synteny block?: BlockID0025700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1221 (gmk)
    N315:
    SA1052 (gmk)
    NCTC8325:
    Newman:
    NWMN_1120 (gmk)
    USA300_FPR3757:
    04-02981:
    SA2981_1167 (gmk)
    08BA02176:
    C248_1239
    11819-97:
    MS7_1167 (gmk)
    71193:
    ST398NM01_1207
    ECT-R 2:
    ECTR2_1065 (gmk)
    ED133:
    SAOV_1212 (gmk)
    ED98:
    SAAV_1181 (gmk)
    HO 5096 0412:
    SAEMRSA15_10420
    JH1:
    SaurJH1_1293 (gmk)
    JH9:
    SaurJH9_1268 (gmk)
    JKD6008:
    SAA6008_01164 (gmk)
    JKD6159:
    SAA6159_01062 (gmk)
    LGA251:
    SARLGA251_11200 (gmk)
    M013:
    M013TW_1147
    MRSA252:
    SAR1185 (gmk)
    MSHR1132:
    SAMSHR1132_10500
    MSSA476:
    SAS1143 (gmk)
    Mu3:
    SAHV_1199 (gmk)
    Mu50:
    SAV1209 (gmk)
    MW2:
    MW1092 (gmk)
    RF122:
    SAB1073 (gmk)
    ST398:
    SAPIG1207 (gmk)
    T0131:
    SAT0131_01258 (moaE)
    TCH60:
    HMPREF0772_12023 (gmk)
    TW20:
    SATW20_12030 (gmk)
    USA300_TCH1516:
    USA300HOU_1147 (gmk)
    VC40:
    SAVC_05210 (gmk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
    N315            MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
    NCTC8325        MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
    Newman          MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
    USA300_FPR3757  MDNEKGLLIVLSGPSGVGKGTVRKRIFEDPSTSYKYSISMTTRQMREGEVDGVDYFFKTR
                    ************************************************************

    COL             DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
    N315            DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
    NCTC8325        DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
    Newman          DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
    USA300_FPR3757  DAFEALIKDDQFIEYAEYVGNYYGTPVQYVKDTMDEGHDVFLEIEVEGAKQVRKKFPDAL
                    ************************************************************

    COL             FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
    N315            FIFLAPPSLDHLRERLVGRGTESNEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
    NCTC8325        FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
    Newman          FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
    USA300_FPR3757  FIFLAPPSLEHLRERLVGRGTESDEKIQSRINEARKEVEMMNLYDYVVVNDEVELAKNRI
                    *********:*************:************************************

    COL             QCIVEAEHLKRERVEAKYRKMILEAKK
    N315            QCIVEAEHLKRERVEAKYRKMILEAKK
    NCTC8325        QCIVEAEHLKRERVEAKYRKMILEAKK
    Newman          QCIVEAEHLKRERVEAKYRKMILEAKK
    USA300_FPR3757  QCIVEAEHLKRERVEAKYRKMILEAKK
                    ***************************