From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003500000
  • symbol?: sun
  • description?: 16S rRNA (cytosine(967)-C(5))-methyltransferase

      descriptions from strain specific annotations:

    • 16S rRNA (cytosine(967)-C(5))-methyltransferase
    • sun protein
    • ribosomal RNA small subunit methyltransferase B
    • 16S rRNA m(5)C 967 methyltransferase
    • 16S rRNA methyltransferase B
    • RNA-binding protein
    • RNA-binding Sun protein
    • rRNA (cytosine-5-)-methyltransferase
    • SA1060 protein
  • strand?: +
  • coordinates?: 3839410..3840795
  • synteny block?: BlockID0025790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1229 (sun)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1175
    08BA02176:
    C248_1247
    11819-97:
    MS7_1175 (sun)
    71193:
    ST398NM01_1216
    ECT-R 2:
    ECTR2_1073 (sun)
    ED133:
    SAOV_1220
    ED98:
    SAAV_1189 (sun)
    HO 5096 0412:
    SAEMRSA15_10500
    JH1:
    SaurJH1_1301
    JH9:
    SaurJH9_1276
    JKD6008:
    SAA6008_01172 (sun)
    JKD6159:
    SAA6159_01070 (sun)
    LGA251:
    SARLGA251_11280 (rsmB)
    M013:
    M013TW_1155
    MRSA252:
    SAR1193
    MSHR1132:
    SAMSHR1132_10580
    MSSA476:
    SAS1151
    Mu3:
    SAHV_1207
    Mu50:
    SAV1217
    MW2:
    MW1100
    RF122:
    SAB1081 (sun)
    ST398:
    SAPIG1216 (sun)
    T0131:
    SAT0131_01266 (modB)
    TCH60:
    HMPREF0772_12015 (rsmB)
    TW20:
    SATW20_12110 (rsmB)
    USA300_TCH1516:
    USA300HOU_1154
    VC40:
    SAVC_05250

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------------------------MIENVRSLAFDTIQDILNEGAYSNLRINEVLSEN
    N315            MSWEKENVSCQLFKWCAKHTSREETYMIENVRSLAFDTIQDILNEGAYSNLRINEVLSEN
    NCTC8325        --------------------------MIENVRSLAFDTIQDILNEGAYSNLRINEVLSEN
    Newman          --------------------------MIENVRSLAFDTIQDILNEGAYSNLRINEVLSEN
    USA300_FPR3757  --------------------------MIENVRSLAFDTIQDILNEGAYSNLRINEVLSEN
                                              **********************************

    COL             ELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNH
    N315            ELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNH
    NCTC8325        ELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNH
    Newman          ELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNH
    USA300_FPR3757  ELNAMDKALFTEIVYGTVKRKYTLDFYLKPFVKTKIKAWVRQLLWMSIYQYVYLDKVPNH
                    ************************************************************

    COL             AIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDH
    N315            AIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDH
    NCTC8325        AIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDH
    Newman          AIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDH
    USA300_FPR3757  AIINEAVEIAKERGGYHNGNVVNGILRTMMRSDLPDFNEIADPKKRMAIEYSMPKWIIDH
                    ************************************************************

    COL             WATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHI
    N315            WATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHI
    NCTC8325        WATHYGLEETEKILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHI
    Newman          WATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHI
    USA300_FPR3757  WATHYGLEETETILQSFLETTSTTVRANLTRASLDDIIEKLQDEGYDVEKDHDLPYCLHI
                    ***********.************************************************

    COL             GGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEG
    N315            GGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEG
    NCTC8325        GGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEG
    Newman          GGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEG
    USA300_FPR3757  GGQPIIHSRSFKDGFVSIQDKSSMFVAHIMNVDRHDHVLDACSAPGGKACHIAEVLMPEG
                    ************************************************************

    COL             QVDASDIHDHKIDLINFNIKKLRLTNIKAFQHDATKPYDKTYDKILVDAPCSGLGVMRHK
    N315            QVDASDIHDHKIDLINFNIKKLRLTNIKAFQHDATKPYDKTYDKILVDAPCSGLGVMRHK
    NCTC8325        QVDASDIHDHKIDLINFNIKKLRLTNIKAFQHDATKPYDKTYDKILVDAPCSGLGVMRHK
    Newman          QVDASDIHDHKIDLINFNIKKLRLTNIKAFQHDATKPYDKTYDKILVDAPCSGLGVMRHK
    USA300_FPR3757  QVDASDIHDHKIDLINFNIKKLRLTNIKAFQYDATKPYDKTYDKILVDAPCSGLGVMRHK
                    *******************************:****************************

    COL             PEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNK
    N315            PEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNK
    NCTC8325        PEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNK
    Newman          PEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNK
    USA300_FPR3757  PEIKYTQSKQHIESLVELQLEILENVKNNVKIGGEIIYSTCTIEQLENENVIYTFLKNNK
                    ************************************************************

    COL             NFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN
    N315            NFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN
    NCTC8325        NFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN
    Newman          NFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN
    USA300_FPR3757  NFEFEPFQHPITGELVKTLQIMPQDFNSDGFFITKIKRKDN
                    *****************************************