From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003501000
  • symbol?: rlmN
  • description?: ribosomal RNA large subunit methyltransferase N

      descriptions from strain specific annotations:

    • ribosomal RNA large subunit methyltransferase N
    • radical SAM superfamily protein
    • cfr family radical SAM enzyme
    • Ribosomal RNA large subunit methyltransferase N, Rlmn
    • 23S rRNA methyltransferase
    • radical SAM enzyme, Cfr family
    • radical SAM protein
  • strand?: +
  • coordinates?: 3840798..3841892
  • synteny block?: BlockID0025800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1176
    08BA02176:
    C248_1248
    11819-97:
    MS7_1176 (rlmN)
    71193:
    ST398NM01_1217
    ECT-R 2:
    ECTR2_1074
    ED133:
    SAOV_1221
    ED98:
    SAAV_1190
    HO 5096 0412:
    SAEMRSA15_10510
    JH1:
    SaurJH1_1302
    JH9:
    SaurJH9_1277
    JKD6008:
    SAA6008_01173 (rlmN)
    JKD6159:
    SAA6159_01071 (rlmN)
    LGA251:
    SARLGA251_11290 (rlmN)
    M013:
    M013TW_1156
    MRSA252:
    SAR1194
    MSHR1132:
    SAMSHR1132_10590
    MSSA476:
    SAS1152
    Mu3:
    SAHV_1208
    Mu50:
    SAV1218
    MW2:
    MW1101
    RF122:
    SAB1082
    ST398:
    SAPIG1217
    T0131:
    SAT0131_01267 (modA)
    TCH60:
    HMPREF0772_12014
    TW20:
    SATW20_12120 (rlmN)
    USA300_TCH1516:
    USA300HOU_1155
    VC40:
    SAVC_05255

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MITAEKKKKNKFLPNFDKQSIYSLRFDEMQNWLVEQGQQKFRAKQIFEWLYQKRVDSIDE
    N315            MITAEKKKKNKFLPNFDKQSIYSLRFDEMQNWLVEQGQQKFRAKQIFEWLYQKRVDSIDE
    NCTC8325        MITAEKKKKNKFLPNFDKQSIYSLRFDEMQNWLVEQGQQKFRAKQIFEWLYQKRVDSIDE
    Newman          MITAEKKKKNKFLPNFDKQSIYSLRFDEMQNWLVEQGQQKFRAKQIFEWLYQKRVDSIDE
    USA300_FPR3757  MITAEKKKKNKFLPNFDKQSIYSLRFDEMQNWLVEQGQQKFRAKQIFEWLYQKRVDSIDE
                    ************************************************************

    COL             MTNLSKDLRQLLKDNFTVTTLTTVVKQESKDGTIKFLFELQDGYTIETVLMRHDYGNSVC
    N315            MTNLSKDLRQLLKDNFTVTTLTTVVKQESKDGTIKFLFELQDGYTIETVLMRHDYGNSVC
    NCTC8325        MTNLSKDLRQLLKDNFTVTTLTTVVKQESKDGTIKFLFELQDGYTIETVLMRHDYGNSVC
    Newman          MTNLSKDLRQLLKDNFTVTTLTTVVKQESKDGTIKFLFELQDGYTIETVLMRHDYGNSVC
    USA300_FPR3757  MTNLSKDLRQLLKDNFTVTTLTTVVKQESKDGTIKFLFELQDGYTIETVLMRHDYGNSVC
                    ************************************************************

    COL             VTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDATEERVSQIVIMGIGEPF
    N315            VTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDATEERVSQIVIMGIGEPF
    NCTC8325        VTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDATEERVSQIVIMGIGEPF
    Newman          VTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDATEERVSQIVIMGIGEPF
    USA300_FPR3757  VTTQVGCRIGCTFCASTLGGLKRNLEAGEIVSQVLTVQKALDATEERVSQIVIMGIGEPF
                    ************************************************************

    COL             ENYDEMMDFLRIVNDDNSLNIGARHITVSTSGIIPRIYDFADEDIQINFAVSLHAAKDEV
    N315            ENYDEMMDFLRIVNDDNSLNIGARHITVSTSGIIPRIYDFADEDIQINFAVSLHAAKDEV
    NCTC8325        ENYDEMMDFLRIVNDDNSLNIGARHITVSTSGIIPRIYDFADEDIQINFAVSLHAAKDEV
    Newman          ENYDEMMDFLRIVNDDNSLNIGARHITVSTSGIIPRIYDFADEDIQINFAVSLHAAKDEV
    USA300_FPR3757  ENYDEMMDFLRIVNDDNSLNIGARHITVSTSGIIPRIYDFADEDIQINFAVSLHAAKDEV
                    ************************************************************

    COL             RSRLMPINRAYNVEKLIEAIQYYQEKTNRRVTFEYGLFGGVNDQLEHARELAHLIKGLNC
    N315            RSRLMPINRAYNVEKLIEAIQYYQEKTNRRVTFEYGLFGGVNDQLEHARELAHLIKGLNC
    NCTC8325        RSRLMPINRAYNVEKLIEAIQYYQEKTNRRVTFEYGLFGGVNDQLEHARELAHLIKGLNC
    Newman          RSRLMPINRAYNVEKLIEAIQYYQEKTNRRVTFEYGLFGGVNDQLEHARELAHLIKGLNC
    USA300_FPR3757  RSRLMPINRAYNVEKLIEAIQYYQEKTNRRVTFEYGLFGGVNDQLEHARELAHLIKGLNC
                    ************************************************************

    COL             HVNLIPVNHVPERNYVKTAKNDIFKFEKELKRLGINATIRREQGSDIDAACGQLRAKERQ
    N315            HVNLIPVNHVPERNYVKTAKNDIFKFEKELKRLGINATIRREQGSDIDAACGQLRAKERQ
    NCTC8325        HVNLIPVNHVPERNYVKTAKNDIFKFEKELKRLGINATIRREQGSDIDAACGQLRAKERQ
    Newman          HVNLIPVNHVPERNYVKTAKNDIFKFEKELKRLGINATIRREQGSDIDAACGQLRAKERQ
    USA300_FPR3757  HVNLIPVNHVPERNYVKTAKNDIFKFEKELKRLGINATIRREQGSDIDAACGQLRAKERQ
                    ************************************************************

    COL             VETR
    N315            VETR
    NCTC8325        VETR
    Newman          VETR
    USA300_FPR3757  VETR
                    ****