From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003505000
  • symbol?: cfxE
  • description?: ribulose-5-phosphate 3-epimerase-like protein

      descriptions from strain specific annotations:

    • ribulose-5-phosphate 3-epimerase-like protein
    • ribulose-phosphate 3-epimerase
    • putative ribulose-phosphate 3-epimerase
    • Ribulose-5-phosphate 3-epimerase
  • strand?: +
  • coordinates?: 3845857..3846501
  • synteny block?: BlockID0025840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1235 (rpe)
    N315:
    SA1065 (cfxE)
    NCTC8325:
    Newman:
    NWMN_1132 (rpe)
    USA300_FPR3757:
    04-02981:
    SA2981_1180 (cfxE)
    08BA02176:
    C248_1252
    11819-97:
    MS7_1180 (rpe)
    71193:
    ST398NM01_1221
    ECT-R 2:
    ECTR2_1078 (rpe)
    ED133:
    SAOV_1225
    ED98:
    SAAV_1194 (rpe)
    HO 5096 0412:
    SAEMRSA15_10550
    JH1:
    SaurJH1_1306
    JH9:
    SaurJH9_1281
    JKD6008:
    SAA6008_01177 (rpe)
    JKD6159:
    SAA6159_01075 (rpe)
    LGA251:
    SARLGA251_11330
    M013:
    M013TW_1160
    MRSA252:
    SAR1198
    MSHR1132:
    SAMSHR1132_10630
    MSSA476:
    SAS1156
    Mu3:
    SAHV_1212 (cfxE)
    Mu50:
    SAV1222 (cfxE)
    MW2:
    MW1105 (cfxE)
    RF122:
    SAB1086
    ST398:
    SAPIG1221 (rpe)
    T0131:
    SAT0131_01271
    TCH60:
    HMPREF0772_12010 (rpe)
    TW20:
    SATW20_12160
    USA300_TCH1516:
    USA300HOU_1159 (cfxE)
    VC40:
    SAVC_05275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTL
    N315            MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTL
    NCTC8325        MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTL
    Newman          MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTL
    USA300_FPR3757  MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTL
                    ************************************************************

    COL             PIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPI
    N315            PIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPI
    NCTC8325        PIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPI
    Newman          PIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPI
    USA300_FPR3757  PIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPI
                    ************************************************************

    COL             SQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTD
    N315            SQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTD
    NCTC8325        SQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTD
    Newman          SQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTD
    USA300_FPR3757  SQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTD
                    ************************************************************

    COL             TAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG
    N315            TAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG
    NCTC8325        TAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG
    Newman          TAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG
    USA300_FPR3757  TAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG
                    **********************************