From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1065 [new locus tag: SA_RS06040 ]
  • pan locus tag?: SAUPAN003505000
  • symbol: cfxE
  • pan gene symbol?: cfxE
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1065 [new locus tag: SA_RS06040 ]
  • symbol: cfxE
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1205482..1206126
  • length: 645
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGACAAAACTATATCCATCATTATTATCTGTTGATTTTTTGGATTTACAACATGAATTA
    AAACGACTTGAAGAAGCAGGTGTCGACGGAGTTCATTTTGATGTTATGGATGGTCAATTT
    GTGCCTAATATATCTATTGGTTTACCAATATTAGATGCAGTAAGAAAAGGCACAACATTA
    CCTATAGACGTACATTTGATGATTGAAAATCCAGAAAAGTATATTGCATCATTTGCAGAA
    CATGGTGCCGATATGATTTCAATTCATGTCGAATCAACGCCTCATATTCATCGTGCTATT
    CAAATGATTAAACATTTAGATAAAAAAGCTGGTGTAGTAATTAATCCTGGTACACCAATA
    TCACAAATTGAACCTATTTTAGACATTGTTGATTATGTATTAGTGATGACAGTTAACCCA
    GGGTTTGGTGGTCAATCATTTATTGATCAATGCGTAGAAAAAATAGCGGGTCTTAATGCT
    ATTAAAATGGAACGTCAATTAAACTTTGATATTGAAGTTGATGGAGGCGTAAATACCGAT
    ACAGCGAAAGTTTGTGTTGAAAATGGTGCTACAATGCTAGTAACAGGTTCATTTTTCTTT
    AAACAAGAAGATTATAAAAAAGTCACACAAGCATTGAAAGGTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    645

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1065 [new locus tag: SA_RS06040 ]
  • symbol: CfxE
  • description: hypothetical protein
  • length: 214
  • theoretical pI: 4.91189
  • theoretical MW: 23572.1
  • GRAVY: 0.0668224

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismPentose phosphate pathwayribulose-phosphate 3-epimerase (TIGR01163; EC 5.1.3.1; HMM-score: 274.9)
    3-hexulose-6-phosphate synthase (TIGR03128; EC 4.1.2.43; HMM-score: 24.5)
    MetabolismAmino acid biosynthesisHistidine familyphosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (TIGR02129; EC 5.3.1.16; HMM-score: 13.7)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismPentose phosphate pathway Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 
    One-carbon MetabolismFormaldehyde assimilation: Ribulose monophosphate pathway Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 
    DNA MetabolismDNA repair2-phosphoglycolate salvage Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 
    A Gram-positive cluster that relates ribosomal protein L28P to a set of uncharacterized proteins Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 
    Conserved gene cluster associated with Met-tRNA formyltransferase Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 
  • PFAM:
    TIM_barrel (CL0036) Ribul_P_3_epim; Ribulose-phosphate 3 epimerase family (PF00834; HMM-score: 252.8)
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 14.9)
    QRPTase_C; Quinolinate phosphoribosyl transferase, C-terminal domain (PF01729; HMM-score: 14)
    PBP (CL0177) PBP_like; PBP superfamily domain (PF12727; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.131
    • Ymax_pos: 26
    • Cmax: 0.109
    • Cmax_pos: 26
    • Smax: 0.233
    • Smax_pos: 21
    • Smean: 0.127
    • D: 0.129
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

  • GI: 15926805 NCBI
  • RefSeq: NP_374338 NCBI
  • UniProt:

Protein sequence[edit source | edit]

  • MTKLYPSLLSVDFLDLQHELKRLEEAGVDGVHFDVMDGQFVPNISIGLPILDAVRKGTTLPIDVHLMIENPEKYIASFAEHGADMISIHVESTPHIHRAIQMIKHLDKKAGVVINPGTPISQIEPILDIVDYVLVMTVNPGFGGQSFIDQCVEKIAGLNAIKMERQLNFDIEVDGGVNTDTAKVCVENGATMLVTGSFFFKQEDYKKVTQALKG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]