From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1064 [new locus tag: SA_RS06035 ]
  • pan locus tag?: SAUPAN003504000
  • symbol: SA1064
  • pan gene symbol?: rsgA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1064 [new locus tag: SA_RS06035 ]
  • symbol: SA1064
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1204606..1205481
  • length: 876
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    TTGAAGACAGGTCGAATAGTGAAATCAATTAGTGGGGTATATCAAGTAGACGTTAATGGC
    GAACGTTTCAATACAAAACCACGAGGATTATTTAGAAAGAAAAAATTTTCACCGGTAGTT
    GGTGATATAGTGGAATTTGAAGTACAAAACATTAACGAAGGCTATATTCATCAAGTGTTT
    GAGCGGAAAAATGAGTTGAAAAGACCACCTGTAAGTAATATAGATACACTAGTAATTGTA
    ATGAGTGCTGTCGAGCCAAATTTTTCAACGCAATTATTAGATCGATTTTTAGTTATTGCA
    CATTCGTATCAGTTAAATGCGAGAGTTTTGGTGACTAAAAAAGATAAAACACCAATTGAA
    AAGCAGTTCGAAATTAATGAGTTGTTGAAAATATATGAAAATATTGGCTATGAGACTGAA
    TTTATTGGAAATGATGATGATCGAAAAAAAATTGTAGAAGCTTGGCCAGCTGGACTTATA
    GTACTTAGTGGTCAATCAGGTGTCGGTAAGTCCACTTTCTTAAATCATTATCGTCCAGAA
    CTTAATCTTGAGACAAATGATATATCAAAATCATTAAATCGAGGAAAGCATACTACAAGA
    CATGTCGAACTATTCGAACGTCAAAACGGTTATATTGCAGACACACCTGGATTCAGTGCT
    TTAGATTTTGATCATATAGATAAAGATGAAATAAAAGATTATTTTCTTGAATTAAATCGA
    TATGGTGAAACATGTAAGTTTAGGAATTGTAATCATATCAAAGAACCTAATTGTAATGTT
    AAGCATCAATTAGAGATAGGGAATATTGCGCAATTTAGATACGACCATTATTTACAACTA
    TTTAATGAAATTTCAAATAGAAAGGTTAGATATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    876

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1064 [new locus tag: SA_RS06035 ]
  • symbol: SA1064
  • description: hypothetical protein
  • length: 291
  • theoretical pI: 8.42051
  • theoretical MW: 33875.2
  • GRAVY: -0.580412

Function[edit source | edit]

  • reaction:
    EC 3.6.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein synthesisTranslation factorsribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 246.2)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 23.8)
    Unknown functionGeneralsmall GTP-binding protein domain (TIGR00231; HMM-score: 17.1)
    Genetic information processingProtein synthesisOtherribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 15.4)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesNucleotide and nucleoside interconversionsguanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.7)
    Cellular processesCellular processesToxin production and resistanceputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 12.3)
    MetabolismTransport and binding proteinsUnknown substrateputative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 12.3)
  • TheSEED:  
    A Gram-positive cluster that relates ribosomal protein L28P to a set of uncharacterized proteins Ribosome small subunit biogenesis RbfA-release protein RsgA 
    Universal GTPases Ribosome small subunit biogenesis RbfA-release protein RsgA 
  • PFAM:
    P-loop_NTPase (CL0023) RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 179.5)
    OB (CL0021) RsgA_N; RsgA N-terminal domain (PF16745; HMM-score: 70)
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 25)
    AAA_22; AAA domain (PF13401; HMM-score: 17.3)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 16.6)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.8)
    ABC_tran; ABC transporter (PF00005; HMM-score: 15.1)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 14.5)
    AAA_18; AAA domain (PF13238; HMM-score: 14.3)
    AAA_23; AAA domain (PF13476; HMM-score: 14.3)
    KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 13.7)
    AAA_24; AAA domain (PF13479; HMM-score: 13.6)
    AAA_25; AAA domain (PF13481; HMM-score: 13.4)
    AAA_33; AAA domain (PF13671; HMM-score: 13.4)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.116
    • Ymax_pos: 24
    • Cmax: 0.111
    • Cmax_pos: 24
    • Smax: 0.204
    • Smax_pos: 1
    • Smean: 0.117
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTGRIVKSISGVYQVDVNGERFNTKPRGLFRKKKFSPVVGDIVEFEVQNINEGYIHQVFERKNELKRPPVSNIDTLVIVMSAVEPNFSTQLLDRFLVIAHSYQLNARVLVTKKDKTPIEKQFEINELLKIYENIGYETEFIGNDDDRKKIVEAWPAGLIVLSGQSGVGKSTFLNHYRPELNLETNDISKSLNRGKHTTRHVELFERQNGYIADTPGFSALDFDHIDKDEIKDYFLELNRYGETCKFRNCNHIKEPNCNVKHQLEIGNIAQFRYDHYLQLFNEISNRKVRY

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]