From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003508000
  • symbol?:
  • description?: Asp23/Gls24 family envelope stress response protein

      descriptions from strain specific annotations:

    • Asp23/Gls24 family envelope stress response protein
    • Alkaline-shock protein
    • general stress protein, Gls24 family
    • Putative alkaline-shock protein
  • strand?: +
  • coordinates?: 3848194..3848592
  • synteny block?: BlockID0025870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1183
    08BA02176:
    C248_1255
    11819-97:
    MS7_1183
    71193:
    ST398NM01_1224
    ECT-R 2:
    ECTR2_1081
    ED133:
    SAOV_1228
    ED98:
    SAAV_1197
    HO 5096 0412:
    SAEMRSA15_10580
    JH1:
    SaurJH1_1309
    JH9:
    SaurJH9_1284
    JKD6008:
    SAA6008_01180
    JKD6159:
    SAA6159_01078
    LGA251:
    SARLGA251_11360
    M013:
    M013TW_1163
    MRSA252:
    SAR1201
    MSHR1132:
    SAMSHR1132_10660
    MSSA476:
    SAS1159
    Mu3:
    SAHV_1215
    Mu50:
    SAV1225
    MW2:
    MW1108
    RF122:
    SAB1089
    ST398:
    SAPIG1224
    T0131:
    SAT0131_01274
    TCH60:
    HMPREF0772_12007 (asp4)
    TW20:
    SATW20_12190
    USA300_TCH1516:
    USA300HOU_1161
    VC40:
    SAVC_05290

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLEISNDYGKIDISNEVIASVVGGKAVECYGIVGMASRQQVRDGIAEILGHENYAKGIK
    N315            MTLEISNDYGKIDISNEVIASVVGGKAVECYGIVGMASRQQVRDGIAEILGHENYAKGIK
    NCTC8325        MTLEISNDYGKIDISNEVIASVVGGKAVECYGIVGMASRQQVRDGIAEILGHENYAKGIK
    Newman          MTLEISNDYGKIDISNEVIASVVGGKAVECYGIVGMASRQQVRDGIAEILGHENYAKGIK
    USA300_FPR3757  MTLEISNDYGKIDISNEVIASVVGGKAVECYGIVGMASRQQVRDGIAEILGHENYAKGIK
                    ************************************************************

    COL             VTENNGVVDIDMYIIVSYGVKISEVANNVQSTVKYTLEKSLNVSVNSINIYVQGVRVNNT
    N315            VTENNGVVDIDMYIIVSYGVKISEVANNVQSTVKYTLEKSLNVSVNSINIYVQGVRVNNT
    NCTC8325        VTENNGVVDIDMYIIVSYGVKISEVANNVQSTVKYTLEKSLNVSVNSINIYVQGVRVNNT
    Newman          VTENNGVVDIDMYIIVSYGVKISEVANNVQSTVKYTLEKSLNVSVNSINIYVQGVRVNNT
    USA300_FPR3757  VTENNGVVDIDMYIIVSYGVKISEVANNVQSTVKYTLEKSLNVSVNSINIYVQGVRVNNT
                    ************************************************************

    COL             GKKA
    N315            GKKA
    NCTC8325        GKKA
    Newman          GKKA
    USA300_FPR3757  GKKA
                    ****