From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan003512000
  • symbol?: fapR
  • description?: fatty acid biosynthesis transcriptional regulator

      descriptions from strain specific annotations:

    • fatty acid biosynthesis transcriptional regulator
    • transcription factor FapR
    • fatty acid and phospholipid biosynthesis transcriptional regulator
    • transcription factor FapR (Fatty acid and phospholipid biosynthesisregulator)
    • PaaI family protein
    • transcription regulator FapR
  • strand?: +
  • coordinates?: 3852929..3853501
  • synteny block?: BlockID0025910
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1186 (fapR)
    08BA02176:
    C248_1258
    11819-97:
    MS7_1186 (fapR)
    71193:
    ST398NM01_1227
    ECT-R 2:
    ECTR2_1084
    ED133:
    SAOV_1231
    ED98:
    SAAV_1200
    HO 5096 0412:
    SAEMRSA15_10610
    JH1:
    SaurJH1_1312
    JH9:
    SaurJH9_1287
    JKD6008:
    SAA6008_01183 (fapR)
    JKD6159:
    SAA6159_01081 (fapR)
    LGA251:
    SARLGA251_11390 (fapR)
    M013:
    M013TW_1166
    MRSA252:
    SAR1204
    MSHR1132:
    SAMSHR1132_10690
    MSSA476:
    SAS1162
    Mu3:
    SAHV_1218
    Mu50:
    SAV1228
    MW2:
    MW1111
    RF122:
    SAB1092
    ST398:
    SAPIG1227
    T0131:
    SAT0131_01277 (ureB)
    TCH60:
    HMPREF0772_12004
    TW20:
    SATW20_12220 (fapR)
    USA300_TCH1516:
    USA300HOU_1164
    VC40:
    SAVC_05305

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIK
    N315            -----MKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIK
    NCTC8325        MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIK
    Newman          MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIK
    USA300_FPR3757  MRGETLKLKKDKRREAIRQQIDSNPFITDHELSDLFQVSIQTIRLDRTYLNIPELRKRIK
                         :******************************************************

    COL             LVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANS
    N315            LVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANS
    NCTC8325        LVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANS
    Newman          LVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANS
    USA300_FPR3757  LVAEKNYDQISSIEEQEFIGDLIQVNPNVKAQSILDITSDSVFHKTGIARGHVLFAQANS
                    ************************************************************

    COL             LCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKG
    N315            LCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKG
    NCTC8325        LCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKG
    Newman          LCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKG
    USA300_FPR3757  LCVALIKQPTVLTHESSIQFIEKVKLNDTVRAEARVVNQTAKHYYVEVKSYVKHTLVFKG
                    ************************************************************

    COL             NFKMFYDKRG
    N315            NFKMFYDKRG
    NCTC8325        NFKMFYDKRG
    Newman          NFKMFYDKRG
    USA300_FPR3757  NFKMFYDKRG
                    **********