From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003522000
  • symbol?: ftsY
  • description?: signal recognition particle protein

      descriptions from strain specific annotations:

    • signal recognition particle protein
    • signal recognition particle-docking protein FtsY
    • cell division protein FtsY, putative
    • Signal recognition particle receptor protein FtsY (=alpha subunit)
    • putative cell division protein
    • type I general secretory pathway protein signal recognition particle protein FtsY
  • strand?: +
  • coordinates?: 3862131..3863381
  • synteny block?: BlockID0026010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1145 (ftsY)
    USA300_FPR3757:
    04-02981:
    SA2981_1193 (ftsY)
    08BA02176:
    C248_1266
    11819-97:
    MS7_1193 (ftsY)
    71193:
    ST398NM01_1235
    ECT-R 2:
    ECTR2_1091 (ftsY)
    ED133:
    SAOV_1238
    ED98:
    SAAV_1208
    HO 5096 0412:
    SAEMRSA15_10680
    JH1:
    SaurJH1_1319
    JH9:
    SaurJH9_1294
    JKD6008:
    SAA6008_01190 (ftsY)
    JKD6159:
    SAA6159_01088 (ftsY)
    LGA251:
    SARLGA251_11460
    M013:
    M013TW_1173
    MRSA252:
    SAR1211
    MSHR1132:
    SAMSHR1132_10760
    MSSA476:
    SAS1169
    Mu3:
    SAHV_1225
    Mu50:
    SAV1235
    MW2:
    MW1118
    RF122:
    SAB1099
    ST398:
    SAPIG1235
    T0131:
    SAT0131_01285
    TCH60:
    HMPREF0772_11996 (ftsY)
    TW20:
    SATW20_12290
    USA300_TCH1516:
    USA300HOU_1172 (ftsY)
    VC40:
    SAVC_05340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFFKRLKDKFATNKENEEVKSLTEEQGQDKLEDTHSEGSTQDANDLAENAEVKKKPRKL
    N315            MSFFKRLKDKFATNKENEEVKSLREEQGQDKLEDTHSEGSTQDVNDLAENAEVKKKPRKL
    NCTC8325        MSFFKRLKDKFATNKENEEVKSLTEEQGQDKLEDTHSEGSTQDANDLAENAEVKKKPRKL
    Newman          MSFFKRLKDKFATNKENEEVKSLTEEQGQDKLEDTHSEGSTQDANDLAENAEVKKKPRKL
    USA300_FPR3757  MSFFKRLKDKFATNKENEEVKSLTEEQGQDKLEDTHSEGSTQDANDLAENAEVKKKPRKL
                    *********************** *******************.****************

    COL             SEADFDDDGLISIEDFEEIEAQKMGAKFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEA
    N315            SEADFDDDGLISIEDFEEIEAQKMGAKFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEA
    NCTC8325        SEADFDDDGLISIEDFEEIEAQKMGAKFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEA
    Newman          SEADFDDDGLISIEDFEEIEAQKMGAKFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEA
    USA300_FPR3757  SEADFDDDGLISIEDFEEIEAQKMGAKFKAGLEKSRQNFQEQLNNLIARYRKVDEDFFEA
                    ************************************************************

    COL             LEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMN
    N315            LEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMN
    NCTC8325        LEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMN
    Newman          LEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMN
    USA300_FPR3757  LEEMLITADVGFNTVMTLTEELRMEAQRRNIQDTEDLREVIVEKIVEIYHQEDDNSEAMN
                    ************************************************************

    COL             LEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERV
    N315            IEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERV
    NCTC8325        LEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERV
    Newman          LEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERV
    USA300_FPR3757  LEDGRLNVILMVGVNGVGKTTTIGKLAYRYKMEGKKVMLAAGDTFRAGAIDQLKVWGERV
                    :***********************************************************

    COL             GVDVISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRA
    N315            GVDVISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRA
    NCTC8325        GVDVISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRA
    Newman          GVDVISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRA
    USA300_FPR3757  GVDVISQSEGSDPAAVMYDAINAAKNKGVDILICDTAGRLQNKTNLMQELEKVKRVINRA
                    ************************************************************

    COL             VPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIP
    N315            VPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIP
    NCTC8325        VPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIP
    Newman          VPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIP
    USA300_FPR3757  VPDAPHEALLCLDATTGQNALSQARNFKEVTNVTGIVLTKLDGTAKGGIVLAIRNELHIP
                    ************************************************************

    COL             VKYVGLGEQLDDLQPFNPESYVYGLFADMIEQNEEITTVENDQIVTEEKDDNHGSK
    N315            VKYVGLGEQLDDLQPFNPESYVYGLFADMIEQNDEITTVENDQIVTEEKDDNHGAK
    NCTC8325        VKYVGLGEQLDDLQPFNPESYVYGLFADMIEQNEEITTVENDQIVTEEKDDNHGSK
    Newman          VKYVGLGEQLDDLQPFNPESYVYGLFADMIEQNEEITTVENDQIVTEEKDDNHGSK
    USA300_FPR3757  VKYVGLGEQLDDLQPFNPESYVYGLFADMIEQNEEITTVENDQIVTEEKDDNHGSK
                    *********************************:********************:*