From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003524000
  • symbol?: ffh
  • description?: signal recognition particle-like protein

      descriptions from strain specific annotations:

    • signal recognition particle-like protein
    • signal recognition particle protein
    • Signal recognition particle, subunit Ffh SRP54
    • Signal recognition particle, subunit FFH/SRP54
    • Signal recognition particle subunit Ffh SRP54
  • strand?: +
  • coordinates?: 3863708..3865093
  • synteny block?: BlockID0026030
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1253 (ffh)
    N315:
    SA1080 (ffh)
    NCTC8325:
    Newman:
    NWMN_1147 (ffh)
    USA300_FPR3757:
    04-02981:
    SA2981_1195 (ffh)
    08BA02176:
    C248_1268 (ffh)
    11819-97:
    MS7_1195 (ffh)
    71193:
    ST398NM01_1237
    ECT-R 2:
    ECTR2_1093 (ffh)
    ED133:
    SAOV_1240
    ED98:
    SAAV_1210 (ffh)
    HO 5096 0412:
    SAEMRSA15_10700 (ffh)
    JH1:
    SaurJH1_1321
    JH9:
    SaurJH9_1296
    JKD6008:
    SAA6008_01192
    JKD6159:
    SAA6159_01090
    LGA251:
    SARLGA251_11480 (ffh)
    M013:
    M013TW_1175
    MRSA252:
    SAR1213 (ffh)
    MSHR1132:
    SAMSHR1132_10780
    MSSA476:
    SAS1171
    Mu3:
    SAHV_1227 (ffh)
    Mu50:
    SAV1237 (ffh)
    MW2:
    MW1120 (ffh)
    RF122:
    SAB1101 (ffh)
    ST398:
    SAPIG1237 (ffh)
    T0131:
    SAT0131_01287
    TCH60:
    HMPREF0772_11994 (ffh)
    TW20:
    SATW20_12310 (ffh)
    USA300_TCH1516:
    VC40:
    SAVC_05350

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALLEADVNFKVVKEFIKTVSERA
    N315            MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALFEADVNFKVVKEFIKTVSERA
    NCTC8325        MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALLEADVNFKVVKEFIKTVSERA
    Newman          MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALLEADVNFKVVKEFIKTVSERA
    USA300_FPR3757  MAFEGLSERLQATMQKMRGKGKLTEADIKIMMREVRLALLEADVNFKVVKEFIKTVSERA
                    ***************************************:********************

    COL             LGSDVMQSLTPGQQVIKIVQDELTQLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
    N315            LGSDVMQSLTPGQQVIKIVQDELTKLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
    NCTC8325        LGSDVMQSLTPGQQVIKIVQDELTQLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
    Newman          LGSDVMQSLTPGQQVIKIVQDELTQLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
    USA300_FPR3757  LGSDVMQSLTPGQQVIKIVQDELTQLMGGENTSINMSNKPPTVVMMVGLQGAGKTTTAGK
                    ************************:***********************************

    COL             LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
    N315            LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
    NCTC8325        LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
    Newman          LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
    USA300_FPR3757  LALLMRKKYNKKPMLVAADIYRPAAINQLQTVGKQIDIPVYSEGDQVKPQQIVTNALKHA
                    ************************************************************

    COL             KEEHLDFVIIDTAGRLHIDEALMNELKEVKDIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
    N315            KEEHLDFVIIDTAGRLHIDEALMNELKEVKEIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
    NCTC8325        KEEHLDFVIIDTAGRLHIDEALMNELKEVKDIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
    Newman          KEEHLDFVIIDTAGRLHIDEALMNELKEVKDIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
    USA300_FPR3757  KEEHLDFVIIDTAGRLHIDEALMNELKEVKDIAKPNEIMLVVDSMTGQDAVNVAESFDDQ
                    ******************************:*****************************

    COL             LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
    N315            LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
    NCTC8325        LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
    Newman          LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
    USA300_FPR3757  LDVTGVTLTKLDGDTRGGAALSIRSVTQKPIKFVGMSEKLDGLELFHPERMASRILGMGD
                    ************************************************************

    COL             VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
    N315            VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
    NCTC8325        VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
    Newman          VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
    USA300_FPR3757  VLSLIEKAQQDVDQEKAKDLEKKMRESSFTLDDFLEQLDQVKNLGPLDDIMKMIPGMNKM
                    ************************************************************

    COL             KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
    N315            KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
    NCTC8325        KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
    Newman          KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
    USA300_FPR3757  KGLDKLNMSEKQIDHIKAIIQSMTPAERNNPDTLNVSRKKRIAKGSGRSLQEVNRLMKQF
                    ************************************************************

    COL             NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
    N315            NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
    NCTC8325        NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
    Newman          NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
    USA300_FPR3757  NDMKKMMKQFTGGGKGKKGKRNQMQNMLKGMNLPF
                    ***********************************