From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003536000
  • symbol?: rnhB
  • description?: ribonuclease HII

      descriptions from strain specific annotations:

    • ribonuclease HII
    • putative ribonuclease HII
    • ribonuclease HII (RNase HII)
    • ribonuclease HII family protein
  • strand?: +
  • coordinates?: 3875507..3876274
  • synteny block?: BlockID0026130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1261 (rnhB)
    N315:
    SA1087 (rnhB)
    NCTC8325:
    Newman:
    NWMN_1154 (rnhB)
    USA300_FPR3757:
    04-02981:
    SA2981_1202 (rnhB)
    08BA02176:
    C248_1275 (rnhB)
    11819-97:
    MS7_1202
    71193:
    ST398NM01_1244
    ECT-R 2:
    ECTR2_1100
    ED133:
    SAOV_1247
    ED98:
    SAAV_1218 (rnhB)
    HO 5096 0412:
    SAEMRSA15_10770 (rnhB)
    JH1:
    SaurJH1_1328 (rnhB)
    JH9:
    SaurJH9_1303 (rnhB)
    JKD6008:
    SAA6008_01199 (rnhB)
    JKD6159:
    SAA6159_01099 (rnhB)
    LGA251:
    SARLGA251_11550 (rnhB)
    M013:
    M013TW_1182
    MRSA252:
    SAR1220 (rnhB)
    MSHR1132:
    SAMSHR1132_10870
    MSSA476:
    SAS1178 (rnhB)
    Mu3:
    SAHV_1234 (rnhB)
    Mu50:
    SAV1244 (rnhB)
    MW2:
    MW1127 (rnhB)
    RF122:
    SAB1108 (rnhB)
    ST398:
    SAPIG1244
    T0131:
    SAT0131_01294
    TCH60:
    HMPREF0772_11987 (rnhB)
    TW20:
    SATW20_12380 (rnhB)
    USA300_TCH1516:
    USA300HOU_1175 (rnhB)
    VC40:
    SAVC_05385 (rnhB)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTY
    N315            MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTY
    NCTC8325        MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTY
    Newman          MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTY
    USA300_FPR3757  MTLTIKEVTQLINAVNTIEELENHECFLDERKGVQNAIARRRKALEKEQALKEKYVEMTY
                    ************************************************************

    COL             FENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPVTKRLELN
    N315            FENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPITKRLELN
    NCTC8325        FENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPVTKRLELN
    Newman          FENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPVTKRLELN
    USA300_FPR3757  FENEILKEHPNAIICGIDEVGRGPLAGPVVACATILNSNHNYLGLDDSKKVPVTKRLELN
                    ****************************************************:*******

    COL             EALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQ
    N315            EALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQ
    NCTC8325        EALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQ
    Newman          EALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQ
    USA300_FPR3757  EALKNEVTAFAYGIATAEEIDEFNIYKATQIAMQRAIDGLSVQPTHLLIDAMTLDNALPQ
                    ************************************************************

    COL             VSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGI
    N315            VSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGI
    NCTC8325        VSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGI
    Newman          VSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGI
    USA300_FPR3757  VSLIKGDARSVSIAAASIMAKVFRDDYMTQLSKDYPEYGFEKNAGYGTKQHLLAIDDIGI
                    ************************************************************

    COL             MKEHRKSFEPIKSLL
    N315            MKEHRKSFEPIKSLL
    NCTC8325        MKEHRKSFEPIKSLL
    Newman          MKEHRKSFEPIKSLL
    USA300_FPR3757  MKEHRKSFEPIKSLL
                    ***************