From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003538000
  • symbol?: sucD
  • description?: succinyl-CoA synthetase subunit alpha

      descriptions from strain specific annotations:

    • succinyl-CoA synthetase subunit alpha
    • Succinyl-CoA ligase [ADP-forming] alpha chain
    • succinyl-CoA ligase
    • succinyl-CoA synthetase alpha chain
    • putative succinyl-CoA ligase
    • Succinyl-CoA ligase alpha chain
    • succinyl-CoA ligase [ADP-forming] subunit alpha
    • succinate-CoA ligase, alpha subunit subfamily
    • succinate--CoA ligase (ADP-forming) alpha subunit
    • succinyl-CoA ligase subunit alpha
  • strand?: +
  • coordinates?: 3877571..3878479
  • synteny block?: BlockID0026150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1263 (sucD)
    N315:
    SA1089 (sucD)
    NCTC8325:
    Newman:
    NWMN_1156 (sucD)
    USA300_FPR3757:
    04-02981:
    SA2981_1204 (sucD)
    08BA02176:
    C248_1277
    11819-97:
    MS7_1204 (sucD)
    71193:
    ST398NM01_1246
    ECT-R 2:
    ECTR2_1102 (sucD)
    ED133:
    SAOV_1249
    ED98:
    SAAV_1220 (sucD)
    HO 5096 0412:
    SAEMRSA15_10790
    JH1:
    SaurJH1_1330
    JH9:
    SaurJH9_1305
    JKD6008:
    SAA6008_01201 (sucD)
    JKD6159:
    SAA6159_01101 (sucD)
    LGA251:
    SARLGA251_11570
    M013:
    M013TW_1184
    MRSA252:
    SAR1222
    MSHR1132:
    SAMSHR1132_10890
    MSSA476:
    SAS1180
    Mu3:
    SAHV_1236 (sucD)
    Mu50:
    SAV1246 (sucD)
    MW2:
    MW1129 (sucD)
    RF122:
    SAB1110
    ST398:
    SAPIG1246 (sucD)
    T0131:
    SAT0131_01296
    TCH60:
    HMPREF0772_11985 (sucD)
    TW20:
    SATW20_12400
    USA300_TCH1516:
    USA300HOU_1177 (sucD)
    VC40:
    SAVC_05395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
    N315            MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
    NCTC8325        MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
    Newman          MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
    USA300_FPR3757  MSVFIDKNTKVMVQGITGSTALFHTKQMLDYGTKIVAGVTPGKGGQVVEGVPVFNTVEEA
                    ************************************************************

    COL             KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
    N315            KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
    NCTC8325        KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
    Newman          KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
    USA300_FPR3757  KNETGATVSVIYVPAPFAADSILEAADADLDMVICITEHIPVLDMVKVKRYLQGRKTRLV
                    ************************************************************

    COL             GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
    N315            GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
    NCTC8325        GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
    Newman          GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
    USA300_FPR3757  GPNCPGVITADECKIGIMPGYIHKKGHVGVVSRSGTLTYEAVHQLTEEGIGQTTAVGIGG
                    ************************************************************

    COL             DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
    N315            DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
    NCTC8325        DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
    Newman          DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
    USA300_FPR3757  DPVNGTNFIDVLKAFNEDDETKAVVMIGEIGGTAEEEAAEWIKANMTKPVVGFIGGQTAP
                    ************************************************************

    COL             PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
    N315            PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
    NCTC8325        PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
    Newman          PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
    USA300_FPR3757  PGKRMGHAGAIISGGKGTAEEKIKTLNSCGVKTAATPSEIGSTLIEAAKEAGIYESLLTV
                    ************************************************************

    COL             NK
    N315            NK
    NCTC8325        NK
    Newman          NK
    USA300_FPR3757  NK
                    **