From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003549000
  • symbol?: gid
  • description?: tRNA (uracil-5-)-methyltransferase Gid

      descriptions from strain specific annotations:

    • tRNA (uracil-5-)-methyltransferase Gid
    • tRNA:m(5)U-54 MTase gid
    • tRNA:m(5)U-54 methyltransferase
    • methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO
    • glucose inhibited division protein A
  • strand?: +
  • coordinates?: 3885202..3886509
  • synteny block?: BlockID0026260
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1268 (gid)
    N315:
    SA1094 (gid)
    NCTC8325:
    Newman:
    NWMN_1161 (gid)
    USA300_FPR3757:
    04-02981:
    SA2981_1209 (gid)
    08BA02176:
    C248_1282
    11819-97:
    MS7_1209 (trmFO)
    71193:
    ST398NM01_1253
    ECT-R 2:
    ECTR2_1107 (trmFO)
    ED133:
    SAOV_1253 (gid)
    ED98:
    SAAV_1225 (gid)
    HO 5096 0412:
    SAEMRSA15_10840
    JH1:
    SaurJH1_1336 (gid)
    JH9:
    SaurJH9_1311 (gid)
    JKD6008:
    SAA6008_01206 (gid)
    JKD6159:
    SAA6159_01106 (gid)
    LGA251:
    SARLGA251_11620 (trmFO)
    M013:
    M013TW_1191
    MRSA252:
    SAR1227 (gid)
    MSHR1132:
    SAMSHR1132_10940
    MSSA476:
    SAS1185 (gid)
    Mu3:
    SAHV_1241 (gid)
    Mu50:
    SAV1251 (gid)
    MW2:
    MW1134 (gid)
    RF122:
    SAB1113 (gid)
    ST398:
    SAPIG1253 (trmFO)
    T0131:
    SAT0131_01302
    TCH60:
    HMPREF0772_11979 (trmFO)
    TW20:
    SATW20_12450 (trmFO)
    USA300_TCH1516:
    USA300HOU_1182 (gid)
    VC40:
    SAVC_05420

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTQTVNVIGAGLAGSEAAYQLAERGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
    N315            MTQTVNVIGAGLAGSEAAYQLAERGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
    NCTC8325        MTQTVNVIGAGLAGSEAAYQLAERGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
    Newman          MTQTVNVIGAGLAGSEAAYQLAERGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
    USA300_FPR3757  MTQTVNVIGAGLAGSEAAYQLAERGIKVNLIEMRPVKQTPAHHTDKFAELVCSNSLRGNA
                    ************************************************************

    COL             LTNGVGVLKEEMRRLNSIIIEAADKARVPAGGALAVDRHDFSGYITETLKNHENITVINE
    N315            LTNGVGVLKEEMRRLNSIIIEAADKARVPAGGALAVDRHDFSGYITETLKNHENITVINE
    NCTC8325        LTNGVGVLKEEMRRLNSIIIEAADKARVPAGGALAVDRHDFSGYITETLKNHENITVINE
    Newman          LTNGVGVLKEEMRRLNSIIIEAADKARVPAGGALAVDRHDFSGYITETLKNHENITVINE
    USA300_FPR3757  LTNGVGVLKEEMRRLNSIIIEAADKARVPAGGALAVDRHDFSGYITETLKNHENITVINE
                    ************************************************************

    COL             EINAIPDGYTIIATGPLTTETLAQEIVDITGKDQLYFYDAAAPIIEKESIDMDKVYLKSR
    N315            EINAIPDGYTIIATGPLTTETLAQEIVDITGKDQLYFYDAAAPIIEKESIDMDKVYLKSR
    NCTC8325        EINAIPDGYTIIATGPLTTETLAQEIVDITGKDQLYFYDAAAPIIEKESIDMDKVYLKSR
    Newman          EINAIPDGYTIIATGPLTTETLAQEIVDITGKDQLYFYDAAAPIIEKESIDMDKVYLKSR
    USA300_FPR3757  EINAIPDGYTIIATGPLTTETLAQEIVDITGKDQLYFYDAAAPIIEKESIDMDKVYLKSR
                    ************************************************************

    COL             YDKGEAAYLNCPMTEDEFNRFYDAVLEAEVAPVNSFEKEKYFEGCMPFEVMAERGRKTLL
    N315            YDKGEAAYLNCPMTEDEFNRFYDAVLEAEVAPVNSFEKEKYFEGCMPFEVMAERGRKTLL
    NCTC8325        YDKGEAAYLNCPMTEDEFNRFYDAVLEAEVAPVNSFEKEKYFEGCMPFEVMAERGRKTLL
    Newman          YDKGEAAYLNCPMTEDEFNRFYDAVLEAEVAPVNSFEKEKYFEGCMPFEVMAERGRKTLL
    USA300_FPR3757  YDKGEAAYLNCPMTEDEFNRFYDAVLEAEVAPVNSFEKEKYFEGCMPFEVMAERGRKTLL
                    ************************************************************

    COL             FGPMKPVGLEDPKTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGAQKEVIKLIPGLEN
    N315            FGPMKPVGLEDPKTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGAQKEVIKLIPGLEN
    NCTC8325        FGPMKPVGLEDPKTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGAQKEVIKLIPGLEN
    Newman          FGPMKPVGLEDPKTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGAQKEVIKLIPGLEN
    USA300_FPR3757  FGPMKPVGLEDPKTGKRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGAQKEVIKLIPGLEN
                    ************************************************************

    COL             VDIVRYGVMHRNTFINSPDVLNEKYELISQPNIQFAGQMTGVEGYVESAASGLVAGINLA
    N315            VDIVRYGVMHRNTFINSPDVLNEKYELISQPNIQFAGQMTGVEGYVESAASGLVAGINLA
    NCTC8325        VDIVRYGVMHRNTFINSPDVLNEKYELISQPNIQFAGQMTGVEGYVESAASGLVAGINLA
    Newman          VDIVRYGVMHRNTFINSPDVLNEKYELISQPNIQFAGQMTGVEGYVESAASGLVAGINLA
    USA300_FPR3757  VDIVRYGVMHRNTFINSPDVLNEKYELISQPNIQFAGQMTGVEGYVESAASGLVAGINLA
                    ************************************************************

    COL             HKILGKGEVVFPRETMIGSMAYYISHAKNNKNFQPMNANFGLLPSLETRIKDKKERYEAQ
    N315            HKILGKGEVVFPRETMIGSMAYYISHAKNNKNFQPMNANFGLLPSLETRIKDKKERYEAQ
    NCTC8325        HKILGKGEVVFPRETMIGSMAYYISHAKNNKNFQPMNANFGLLPSLETRIKDKKERYEAQ
    Newman          HKILGKGEVVFPRETMIGSMAYYISHAKNNKNFQPMNANFGLLPSLETRIKDKKERYEAQ
    USA300_FPR3757  HKILGKGEVVFPRETMIGSMAYYISHAKNNKNFQPMNANFGLLPSLETRIKDKKERYEAQ
                    ************************************************************

    COL             ANRALDYLENFKKTL
    N315            ANRALDYLENFKKTL
    NCTC8325        ANRALDYLENFKKTL
    Newman          ANRALDYLENFKKTL
    USA300_FPR3757  ANRALDYLENFKKTL
                    ***************