From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003557000
  • symbol?: tsf
  • description?: elongation factor Ts

      descriptions from strain specific annotations:

    • elongation factor Ts
    • Translation elongation factor Ts
    • elongation factor EF1B
    • protein translation elongation factor Ts (EF-Ts)
  • strand?: +
  • coordinates?: 3891939..3892820
  • synteny block?: BlockID0026340
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1276 (tsf)
    N315:
    SA1100 (tsf)
    NCTC8325:
    Newman:
    NWMN_1167 (tsf)
    USA300_FPR3757:
    04-02981:
    SA2981_1215
    08BA02176:
    C248_1290 (tsf)
    11819-97:
    MS7_1215 (tsf)
    71193:
    ST398NM01_1259
    ECT-R 2:
    ECTR2_1113 (tsf)
    ED133:
    SAOV_1259 (tfs)
    ED98:
    SAAV_1232 (tsf)
    HO 5096 0412:
    SAEMRSA15_10900 (tsf)
    JH1:
    SaurJH1_1343 (tsf)
    JH9:
    SaurJH9_1317 (tsf)
    JKD6008:
    SAA6008_01212 (tsf)
    JKD6159:
    SAA6159_01112 (tsf)
    LGA251:
    SARLGA251_11680 (tsf)
    M013:
    M013TW_1197
    MRSA252:
    SAR1233 (tsf)
    MSHR1132:
    SAMSHR1132_11000
    MSSA476:
    SAS1191 (tsf)
    Mu3:
    SAHV_1247 (tsf)
    Mu50:
    SAV1257 (tsf)
    MW2:
    MW1140 (tsf)
    RF122:
    SAB1119 (tsf)
    ST398:
    SAPIG1259 (tsf)
    T0131:
    SAT0131_01310
    TCH60:
    HMPREF0772_11973 (tsf)
    TW20:
    SATW20_12510 (tsf)
    USA300_TCH1516:
    USA300HOU_1190 (tsf)
    VC40:
    SAVC_05450 (tsf)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLREKGIAKAAKKADRIAAEG
    N315            MATISAKLVKELRKKTGAGMMDCKKALTETDGDIDKAIDYLREKGIAKAAKKADRIAAEG
    NCTC8325        MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLREKGIAKAAKKADRIAAEG
    Newman          MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLREKGIAKAAKKADRIAAEG
    USA300_FPR3757  MATISAKLVKELREKTGAGMMDCKKALTETDGDIDKAIDYLREKGIAKAAKKADRIAAEG
                    *************:**********************************************

    COL             LVHVETKGNDAVIVEINSETDFVARNEGFQELVKEIANQVLDTKAETVEALMETTLPNGK
    N315            LVHVETKGNDAVIVEINSETDFVARNEGFQELVKEIANQVLDTKAETVEALMETTLPNGK
    NCTC8325        LVHVETKGNDAVIVEINSETDFVARNEGFQELVKEIANQVLDTKAETVEALMETTLPNGK
    Newman          LVHVETKGNDAVIVEINSETDFVARNAGFQELVKEIANQVLDTKAETVEALMETTLPNGK
    USA300_FPR3757  LVHVETKGNDAVIVEINSETDFVARNEGFQELVKEIANQVLDTKAETVEALMETTLPNGK
                    ************************** *********************************

    COL             SVDERIKEAISTIGEKLSVRRFAIRTKTDNDAFGAYLHMGGRIGVLTVVEGSTDEEAARD
    N315            SVDERIKEAISTIGEKLSVRRFAIRTKTDNDAFGAYLHMGGRIGVLTVVEGSTDEEAARD
    NCTC8325        SVDERIKEAISTIGEKLSVRRFAIRTKTDNDAFGAYLHMGGRIGVLTVVEGSTDEEAARD
    Newman          SVDERIKEAISTIGEKLSVRRFAIRTKTDNDAFGAYLHMGGRIGVLTVVEGSTDEEAARD
    USA300_FPR3757  SVDERIKEAISTIGEKLSVRRFAIRTKTDNDAFGAYLHMGGRIGVLTVVEGSTDEEAARD
                    ************************************************************

    COL             VAMHIAAINPKYVSSEQVSEEEINHEREVLKQQALNEGKPENIVEKMVEGRLRKYLQEIC
    N315            VAMHIAAINPKYVSSEQVSEEEINHEREVLKQQALNEGKPENIVEKMVEGRLRKYLQEIC
    NCTC8325        VAMHIAAINPKYVSSEQVSEEEINHEREVLKQQALNEGKPENIVEKMVEGRLRKYLQEIC
    Newman          VAMHIAAINPKYVSSEQVSEEEINHEREVLKQQALNEGKPENIVEKMVEGRLRKYLQEIC
    USA300_FPR3757  VAMHIAAINPKYVSSEQVSEEEINHEREVLKQQALNEGKPENIVEKMVEGRLRKYLQEIC
                    ************************************************************

    COL             AVDQDFVKNPDVTVEAFLKTKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
    N315            AVDQDFVKNPDVTVEAFLKTKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
    NCTC8325        AVDQDFVKNPDVTVEAFLKTKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
    Newman          AVDQDFVKNPDVTVEAFLKTKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
    USA300_FPR3757  AVDQDFVKNPDVTVEAFLKTKGGKLVDFVRYEVGEGMEKREENFADEVKGQMK
                    *****************************************************