From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003565000
  • symbol?: polC
  • description?: DNA polymerase III PolC

      descriptions from strain specific annotations:

    • DNA polymerase III PolC
    • DNA polymerase III alpha subunit
    • DNA polymerase III subunit alpha
    • DNA polymerase III PolC-type
    • DNA polymerase III, alpha subunit, Gram-positive type
  • strand?: +
  • coordinates?: 3899723..3904051
  • synteny block?: BlockID0026420
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1283 (polC)
    N315:
    SA1107 (polC)
    NCTC8325:
    Newman:
    NWMN_1174 (polC)
    USA300_FPR3757:
    04-02981:
    SA2981_1222 (polC)
    08BA02176:
    C248_1297 (polC)
    11819-97:
    MS7_1222 (polC)
    71193:
    ST398NM01_1266
    ECT-R 2:
    ECTR2_1120 (polC)
    ED133:
    SAOV_1266
    ED98:
    SAAV_1239 (polC)
    HO 5096 0412:
    SAEMRSA15_10970 (polC)
    JH1:
    SaurJH1_1350 (polC)
    JH9:
    SaurJH9_1324 (polC)
    JKD6008:
    SAA6008_01219 (polC)
    JKD6159:
    SAA6159_01119 (polC)
    LGA251:
    SARLGA251_11750 (polC)
    M013:
    M013TW_1204
    MRSA252:
    SAR1240 (polC)
    MSHR1132:
    SAMSHR1132_11070
    MSSA476:
    SAS1198 (polC)
    Mu3:
    SAHV_1254 (polC)
    Mu50:
    SAV1264 (polC)
    MW2:
    MW1147 (polC)
    RF122:
    SAB1126 (polC)
    ST398:
    SAPIG1266 (polC)
    T0131:
    SAT0131_01317
    TCH60:
    HMPREF0772_11965 (polC)
    TW20:
    SATW20_12580 (polC)
    USA300_TCH1516:
    USA300HOU_1196 (polC)
    VC40:
    SAVC_05485 (polC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --MTEQQKFKVLADQIKISNQLDAEILNSGELTRIDVSNKNRTWEFHITLPQFLAHEDYL
    N315            MAMTEQQKFKVLADQIKISNQLDAEILNSGELTRIDVSNKNRTWEFHITLPQFLAHEDYL
    NCTC8325        --MTEQQKFKVLADQIKISNQLDAEILNSGELTRIDVSNKNRTWEFHITLPQFLAHEDYL
    Newman          MAMTEQQKFKVLADQIKISNQLDAEILNSGELTRIDVSNKNRTWEFHITLPQFLAHEDYL
    USA300_FPR3757  --MTEQQKFKVLADQIKISNQLDAEILNSGELTRIDVSNKNRTWEFHITLPQFLAHEDYL
                      **********************************************************

    COL             LFINAIEQEFKDIANVTCRFTVTNGTNQDEHAIKYFGHCIDQTALSPKVKGQLKQKKLIM
    N315            LFINAIEQEFKDIANVTCRFTVTNGTNQDEHAIKYFGHCIDQTALSPKVKGQLKQKKLIM
    NCTC8325        LFINAIEQEFKDIANVTCRFTVTNGTNQDEHAIKYFGHCIDQTALSPKVKGQLKQKKLIM
    Newman          LFINAIEQEFKDIANVTCRFTVTNGTNQDEHAIKYFGHCIDQTALSPKVKGQLKQKKLIM
    USA300_FPR3757  LFINAIEQEFKDIANVTCRFTVTNGTNQDEHAIKYFGHCIDQTALSPKVKGQLKQKKLIM
                    ************************************************************

    COL             SGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQEQNLASLEAHI
    N315            SGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQEQNLASLEAHI
    NCTC8325        SGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQEQNLASLEAHI
    Newman          SGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQEQNLASLEAHI
    USA300_FPR3757  SGKVLKVMVSNDIERNHFDKACNGSLIKAFRNCGFDIDKIIFETNDNDQEQNLASLEAHI
                    ************************************************************

    COL             QEEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQIENIKPIESIIEEEFKV
    N315            QEEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQIENIKPIESIIEEEFKV
    NCTC8325        QEEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQIENIKPIESIIEEEFKV
    Newman          QEEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQIENIKPIESIIEEEFKV
    USA300_FPR3757  QEEDEQSARLATEKLEKMKAEKAKQQDNNESAVDKCQIGKPIQIENIKPIESIIEEEFKV
                    ************************************************************

    COL             AIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALSVGKWVRAQ
    N315            AIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALSVGKWVRAQ
    NCTC8325        AIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALSVGKWVRAQ
    Newman          AIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALSVGKWVRAQ
    USA300_FPR3757  AIEGVIFDINLKELKSGRHIVEIKVTDYTDSLVLKMFTRKNKDDLEHFKALSVGKWVRAQ
                    ************************************************************

    COL             GRIEEDTFIRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQA
    N315            GRIEEDTFIRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQA
    NCTC8325        GRIEEDTFIRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQA
    Newman          GRIEEDTFIRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQA
    USA300_FPR3757  GRIEEDTFIRDLVMMMSDIEEIKKATKKDKAEEKRVEFHLHTAMSQMDGIPNIGAYVKQA
                    ************************************************************

    COL             ADWGHPAIAVTDHNVVQAFPDAHAAAEKHGIKMIYGMEGMLVDDGVPIAYKPQDVVLKDA
    N315            ADWGHPAIAVTDHNVVQAFPDAHAAAEKHGIKMIYGMEGMLVDDGVPIAYKPQDVVLKDA
    NCTC8325        ADWGHPAIAVTDHNVVQAFPDAHAAAEKHGIKMIYGMEGMLVDDGVPIAYKPQDVVLKDA
    Newman          ADWGHPAIAVTDHNVVQAFPDAHAAAEKHGIKMIYGMEGMLVDDGVPIAYKPQDVVLKDA
    USA300_FPR3757  ADWGHPAIAVTDHNVVQAFPDAHAAAEKHGIKMIYGMEGMLVDDGVPIAYKPQDVVLKDA
                    ************************************************************

    COL             TYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDM
    N315            TYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDM
    NCTC8325        TYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDM
    Newman          TYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDM
    USA300_FPR3757  TYVVFDVETTGLSNQYDKIIELAAVKVHNGEIIDKFERFSNPHERLSETIINLTHITDDM
                    ************************************************************

    COL             LVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFGPSTNGVIDTLELSRT
    N315            LVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFGPSTNGVIDTLELSRT
    NCTC8325        LVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFGPSTNGVIDTLELSRT
    Newman          LVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFGPSTNGVIDTLELSRT
    USA300_FPR3757  LVDAPEIEEVLTEFKEWVGDAIFVAHNASFDMGFIDTGYERLGFGPSTNGVIDTLELSRT
                    ************************************************************

    COL             INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKL
    N315            INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKL
    NCTC8325        INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKL
    Newman          INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKL
    USA300_FPR3757  INTEYGKHGLNFLAKKYGVELTQHHRAIYDTEATAYIFIKMVQQMKELGVLNHNEINKKL
                    ************************************************************

    COL             SNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVG
    N315            SNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVG
    NCTC8325        SNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVG
    Newman          SNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVG
    USA300_FPR3757  SNEDAYKRARPSHVTLIVQNQQGLKNLFKIVSASLVKYFYRTPRIPRSLLDEYREGLLVG
                    ************************************************************

    COL             TACDEGELFTAVMQKDQSQVEKIAKYYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRL
    N315            TACDEGELFTAVMQKDQSQVEKIAKYYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRL
    NCTC8325        TACDEGELFTAVMQKDQSQVEKIAKYYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRL
    Newman          TACDEGELFTAVMQKDQSQVEKIAKYYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRL
    USA300_FPR3757  TACDEGELFTAVMQKDQSQVEKIAKYYDFIEIQPPALYQDLIDRELIRDTETLHEIYQRL
                    ************************************************************

    COL             IHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQPGNPLNRSTLPEAHFRTTDEMLNEF
    N315            IHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQPGNPLNRSTLPEAHFRTTDEMLNEF
    NCTC8325        IHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQPGNPLNRSTLPEAHFRTTDEMLNEF
    Newman          IHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQPGNPLNRSTLPEAHFRTTDEMLNEF
    USA300_FPR3757  IHAGDTAGIPVIATGNAHYLFEHDGIARKILIASQPGNPLNRSTLPEAHFRTTDEMLNEF
                    ************************************************************

    COL             HFLGEEKAHEIVVKNTNELADRIERVVPIKDELYTPRMEGANEEIRELSYANARKLYGED
    N315            HFLGEEKAHEIVVKNTNELADRIERVVPIKDELYTPRMEGANEEIRELSYTNARKLYGED
    NCTC8325        HFLGEEKAHEIVVKNTNELADRIERVVPIKDELYTPRMEGANEEIRELSYANARKLYGED
    Newman          HFLGEEKAHEIVVKNTNELADRIERVVPIKDELYTPRMEGANEEIRELSYANARKLYGED
    USA300_FPR3757  HFLGEEKAHEIVVKNTNELADRIERVVPIKDELYTPRMEGANEEIRELSYANARKLYGED
                    **************************************************:*********

    COL             LPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEIT
    N315            LPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEIT
    NCTC8325        LPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEIT
    Newman          LPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEIT
    USA300_FPR3757  LPQIVIDRLEKELKSIIGNGFAVIYLISQRLVKKSLDDGYLVGSRGSVGSSFVATMTEIT
                    ************************************************************

    COL             EVNPLPPHYICPNCKTSEFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKG
    N315            EVNPLPPHYICPNCKTSEFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKG
    NCTC8325        EVNPLPPHYICPNCKTSEFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKG
    Newman          EVNPLPPHYICPNCKTSEFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKG
    USA300_FPR3757  EVNPLPPHYICPNCKTSEFFNDGSVGSGFDLPDKTCETCGAPLIKEGQDIPFETFLGFKG
                    ************************************************************

    COL             DKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQGIHK
    N315            DKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQGIHK
    NCTC8325        DKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQGIHK
    Newman          DKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQGIHK
    USA300_FPR3757  DKVPDIDLNFSGEYQPNAHNYTKVLFGEDKVFRAGTIGTVAEKTAFGYVKGYLNDQGIHK
                    ************************************************************

    COL             RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFH
    N315            RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFH
    NCTC8325        RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFH
    Newman          RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFH
    USA300_FPR3757  RGAEIDRLVKGCTGVKRTTGQHPGGIIVVPDYMDIYDFTPIQYPADDQNSAWMTTHFDFH
                    ************************************************************

    COL             SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEILC
    N315            SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEILC
    NCTC8325        SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEILC
    Newman          SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEILC
    USA300_FPR3757  SIHDNVLKLDILGHDDPTMIRMLQDLSGIDPKTIPVDDKEVMQIFSTPESLGVTEDEILC
                    ************************************************************

    COL             KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSS
    N315            KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSS
    NCTC8325        KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSS
    Newman          KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSS
    USA300_FPR3757  KTGTFGVPEFGTGFVRQMLEDTKPTTFSELVQISGLSHGTDVWLGNAQELIKTGICDLSS
                    ************************************************************

    COL             VIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIK
    N315            VIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIK
    NCTC8325        VIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIK
    Newman          VIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIK
    USA300_FPR3757  VIGCRDDIMVYLMYAGLEPSMAFKIMESVRKGKGLTEEMIETMKENEVPDWYLDSCLKIK
                    ************************************************************

    COL             YMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDM
    N315            YMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDM
    NCTC8325        YMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDM
    Newman          YMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDM
    USA300_FPR3757  YMFPKAHAAAYVLMAVRIAYFKVHHPLYYYASYFTIRASDFDLITMIKDKTSIRNTVKDM
                    ************************************************************

    COL             YSRYMDLGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPG
    N315            YSRYMDLGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPG
    NCTC8325        YSRYMDLGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPG
    Newman          YSRYMDLGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPG
    USA300_FPR3757  YSRYMDLGKKEKDVLTVLEIMNEMAHRGYRMQPISLEKSQAFEFIIEGDTLIPPFISVPG
                    ************************************************************

    COL             LGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM
    N315            LGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM
    NCTC8325        LGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM
    Newman          LGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM
    USA300_FPR3757  LGENVAKRIVEARDDGPFLSKEDLNKKAGLSQKIIEYLDELGSLPNLPDKAQLSIFDM
                    **********************************************************