From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003568000
  • symbol?:
  • description?: nucleic-acid-binding protein implicated in transcription termination

      descriptions from strain specific annotations:

    • nucleic-acid-binding protein implicated in transcription termination
    • putative nucleic-acid-binding protein implicated in transcription termination
  • strand?: +
  • coordinates?: 3906029..3906313
  • synteny block?: BlockID0026450
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1225
    08BA02176:
    C248_1300
    11819-97:
    MS7_1225
    71193:
    ST398NM01_1269
    ECT-R 2:
    ECTR2_1123
    ED133:
    SAOV_1269
    ED98:
    SAAV_1242
    HO 5096 0412:
    SAEMRSA15_11000
    JH1:
    SaurJH1_1353
    JH9:
    SaurJH9_1327
    JKD6008:
    SAA6008_01222
    JKD6159:
    SAA6159_01122
    LGA251:
    SARLGA251_11780
    M013:
    M013TW_1207
    MRSA252:
    SAR1243
    MSHR1132:
    SAMSHR1132_11100
    MSSA476:
    SAS1201
    Mu3:
    SAHV_1257
    Mu50:
    SAV1267
    MW2:
    MW1150
    RF122:
    SAB1129
    ST398:
    SAPIG1269
    T0131:
    SAT0131_01320
    TCH60:
    HMPREF0772_11962
    TW20:
    SATW20_12610
    USA300_TCH1516:
    USA300HOU_1199
    VC40:
    SAVC_05500

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQ
    N315            MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQ
    NCTC8325        MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQ
    USA300_FPR3757  MKKKKIPMRKCILSNEMHPKKDMIRVVVNKEGEIFADVTGKKQGRGAYVSKDVAMVEKAQ
                    ************************************************************

    COL             QKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK
    N315            QKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK
    NCTC8325        QKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK
    USA300_FPR3757  QKEILEKYFKASKEQLDPVYKEIIRLIYREEIPK
                    **********************************