From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003574000
  • symbol?: rpsO
  • description?: 30S ribosomal protein S15
  • strand?: +
  • coordinates?: 3911751..3912026
  • synteny block?: BlockID0026510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1292 (rpsO)
    N315:
    SA1116 (rpsO)
    NCTC8325:
    Newman:
    NWMN_1182 (rpsO)
    USA300_FPR3757:
    04-02981:
    SA2981_1231 (rpsO)
    08BA02176:
    C248_1306 (rpsO)
    11819-97:
    MS7_1231 (rpsO)
    71193:
    ST398NM01_1275
    ECT-R 2:
    ECTR2_1129 (rpsO)
    ED133:
    SAOV_1275 (rpsO)
    ED98:
    SAAV_1248 (rpsO)
    HO 5096 0412:
    SAEMRSA15_11060 (rpsO)
    JH1:
    SaurJH1_1359 (rpsO)
    JH9:
    SaurJH9_1333 (rpsO)
    JKD6008:
    SAA6008_01228 (rpsO)
    JKD6159:
    SAA6159_01128 (rpsO)
    LGA251:
    SARLGA251_11840 (rpsO)
    M013:
    M013TW_1213
    MRSA252:
    SAR1249 (rpsO)
    MSHR1132:
    SAMSHR1132_11160
    MSSA476:
    SAS1207 (rpsO)
    Mu3:
    SAHV_1263 (rpsO)
    Mu50:
    SAV1273 (rpsO)
    MW2:
    MW1156 (rpsO)
    RF122:
    SAB1135 (rpsO)
    ST398:
    SAPIG1275 (rpsO)
    T0131:
    SAT0131_01327 (hutI)
    TCH60:
    HMPREF0772_11956 (rpsO)
    TW20:
    SATW20_12670 (rpsO)
    USA300_TCH1516:
    USA300HOU_1205 (rpsO)
    VC40:
    SAVC_05530 (rpsO)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
    N315            MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
    NCTC8325        MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
    Newman          MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
    USA300_FPR3757  MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMV
                    ************************************************************

    COL             GRRRHLLNYLRSKDIQRYRELIKSLGIRR
    N315            GRRRHLLNYLRSKDIQRYRELIKSLGIRR
    NCTC8325        GRRRHLLNYLRSKDIQRYRELIKSLGIRR
    Newman          GRRRHLLNYLRSKDIQRYRELIKSLGIRR
    USA300_FPR3757  GRRRHLLNYLRSKDIQRYRELIKSLGIRR
                    *****************************