Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1292 [new locus tag: SACOL_RS06595 ]
- pan locus tag?: SAUPAN003574000
- symbol: rpsO
- pan gene symbol?: rpsO
- synonym:
- product: 30S ribosomal protein S15
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1292 [new locus tag: SACOL_RS06595 ]
- symbol: rpsO
- product: 30S ribosomal protein S15
- replicon: chromosome
- strand: +
- coordinates: 1305226..1305495
- length: 270
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236227 NCBI
- RefSeq: YP_186149 NCBI
- BioCyc: see SACOL_RS06595
- MicrobesOnline: 912755 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCAATTTCACAAGAACGTAAAAACGAAATCATTAAAGAATACCGTGTACACGAAACT
GATACTGGTTCACCAGAAGTACAAATCGCTGTACTTACTGCAGAAATCAACGCAGTAAAC
GAACACTTACGTACACACAAAAAAGACCACCATTCACGTCGTGGATTATTAAAAATGGTA
GGTCGTCGTAGACATTTATTAAACTACTTACGTAGTAAAGATATTCAACGTTACCGTGAA
TTAATTAAATCACTTGGTATCCGTCGTTAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1292 [new locus tag: SACOL_RS06595 ]
- symbol: RpsO
- description: 30S ribosomal protein S15
- length: 89
- theoretical pI: 11.1219
- theoretical MW: 10608.2
- GRAVY: -0.895506
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS15 (TIGR00952; HMM-score: 135)and 1 morechorismatase, FkbO/Hyg5 family (TIGR04444; EC 4.1.3.-; HMM-score: 14.2)
- TheSEED :
- SSU ribosomal protein S15p (S13e)
- PFAM: S15_NS1 (CL0600) Ribosomal_S15; Ribosomal protein S15 (PF00312; HMM-score: 129.4)and 1 moreCDA (CL0109) YwqJ-deaminase; YwqJ-like deaminase (PF14431; HMM-score: 14)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004453
- TAT(Tat/SPI): 0.000756
- LIPO(Sec/SPII): 0.000507
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHSRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 804 [3]
- interaction partners:
SACOL0842 (eno) phosphopyruvate hydratase [4] (data from MRSA252) SACOL2415 (gpmA) phosphoglyceromutase [4] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [4] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [4] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [4] (data from MRSA252) SACOL1103 (pdhB) pyruvate dehydrogenase complex E1 component subunit beta [4] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [4] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [4] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [4] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [4] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [4] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [4] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [4] (data from MRSA252) SACOL2229 (rplN) 50S ribosomal protein L14 [4] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [4] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [4] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [4] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [4] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [4] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [4] (data from MRSA252) SACOL2112 (rpmE2) 50S ribosomal protein L31 [4] (data from MRSA252) SACOL0589 (rpoC) DNA-directed RNA polymerase subunit beta' [4] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [4] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [4] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [4] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [4] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [4] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [4] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [4] (data from MRSA252) SACOL0095 (spa) immunoglobulin G binding protein A precursor [4] (data from MRSA252) SACOL1448 (sucB) dihydrolipoamide succinyltransferase [4] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [4] (data from MRSA252) SACOL1753 universal stress protein [4] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 10.63 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 4.00 4.01 4.02 4.03 4.04 4.05 4.06 4.07 4.08 4.09 4.10 4.11 4.12 4.13 4.14 4.15 4.16 4.17 4.18 4.19 4.20 4.21 4.22 4.23 4.24 4.25 4.26 4.27 4.28 4.29 4.30 4.31 4.32 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]