Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2237 [new locus tag: SACOL_RS11770 ]
- pan locus tag?: SAUPAN005700000
- symbol: rplW
- pan gene symbol?: rplW
- synonym:
- product: 50S ribosomal protein L23
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2237 [new locus tag: SACOL_RS11770 ]
- symbol: rplW
- product: 50S ribosomal protein L23
- replicon: chromosome
- strand: -
- coordinates: 2305563..2305838
- length: 276
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237341 NCBI
- RefSeq: YP_187047 NCBI
- BioCyc: see SACOL_RS11770
- MicrobesOnline: 913722 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAAGCAAGAGATATTCTTAAGCGCCCCGTAATCACTGAGAAATCTTCTGAAGCAATG
GCTGAAGACAAATACACTTTCGACGTTGATACTCGTGTTAACAAAACACAAGTAAAAATG
GCAGTTGAAGAAATCTTCAACGTAAAAGTTGCAAGTGTTAATATCATGAATTACAAACCT
AAGAAAAAACGTATGGGCCGTTACCAAGGCTATACAAACAAAAGAAGAAAAGCGATTGTA
ACTCTTAAAGAAGGATCAATCGACTTATTTAACTAA60
120
180
240
276
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SACOL2237 [new locus tag: SACOL_RS11770 ]
- symbol: RplW
- description: 50S ribosomal protein L23
- length: 91
- theoretical pI: 10.4702
- theoretical MW: 10605.3
- GRAVY: -0.706593
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL23 (TIGR03636; HMM-score: 36.8)
- TheSEED :
- LSU ribosomal protein L23p (L23Ae)
- PFAM: no clan defined Ribosomal_L23; Ribosomal protein L23 (PF00276; HMM-score: 110.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.012683
- TAT(Tat/SPI): 0.000806
- LIPO(Sec/SPII): 0.001254
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEARDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASVNIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSIDLFN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4] [5]
- quantitative data / protein copy number per cell: 3190 [6]
- interaction partners:
SACOL0833 (clpP) ATP-dependent Clp protease proteolytic subunit [7] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [7] (data from MRSA252) SACOL2130 (deoD) purine nucleoside phosphorylase [7] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [7] (data from MRSA252) SACOL0842 (eno) phosphopyruvate hydratase [7] (data from MRSA252) SACOL1245 (fabG1) 3-oxoacyl-ACP reductase [7] (data from MRSA252) SACOL2117 (fbaA) fructose-bisphosphate aldolase [7] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [7] (data from MRSA252) SACOL1782 (fhs) formate--tetrahydrofolate ligase [7] (data from MRSA252) SACOL1072 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [7] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [7] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [7] (data from MRSA252) SACOL2016 (groEL) chaperonin GroEL [7] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [7] (data from MRSA252) SACOL1206 (ileS) isoleucyl-tRNA synthetase [7] (data from MRSA252) SACOL1477 (ilvA1) threonine dehydratase [7] (data from MRSA252) SACOL1727 (infC) translation initiation factor IF-3 [7] (data from MRSA252) SACOL0240 (ispD) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [7] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [7] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [7] (data from MRSA252) SACOL1838 (pckA) phosphoenolpyruvate carboxykinase [7] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [7] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [7] (data from MRSA252) SACOL1005 (pepF) oligoendopeptidase F [7] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [7] (data from MRSA252) SACOL1982 (ppaC) manganese-dependent inorganic pyrophosphatase [7] (data from MRSA252) SACOL1091 (ptsH) phosphocarrier protein HPr [7] (data from MRSA252) SACOL1092 (ptsI) phosphoenolpyruvate-protein phosphotransferase [7] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [7] (data from MRSA252) SACOL1213 (pyrC) dihydroorotase [7] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [7] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [7] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [7] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [7] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [7] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [7] (data from MRSA252) SACOL0015 (rplI) 50S ribosomal protein L9 [7] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [7] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [7] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [7] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [7] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [7] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [7] (data from MRSA252) SACOL1725 (rplT) 50S ribosomal protein L20 [7] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [7] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [7] (data from MRSA252) SACOL2228 (rplX) 50S ribosomal protein L24 [7] (data from MRSA252) SACOL0545 (rplY) 50S ribosomal protein L25/general stress protein Ctc [7] (data from MRSA252) SACOL1700 (rpmA) 50S ribosomal protein L27 [7] (data from MRSA252) SACOL2112 (rpmE2) 50S ribosomal protein L31 [7] (data from MRSA252) SACOL1516 (rpsA) 30S ribosomal protein S1 [7] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [7] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [7] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [7] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [7] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [7] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [7] (data from MRSA252) SACOL0591 (rpsL) 30S ribosomal protein S12 [7] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [7] (data from MRSA252) SACOL1642 (rpsT) 30S ribosomal protein S20 [7] (data from MRSA252) SACOL1722 (tig) trigger factor [7] (data from MRSA252) SACOL1377 (tkt) transketolase [7] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [7] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [7] (data from MRSA252) SACOL0303 5'-nucleotidase [7] (data from MRSA252) SACOL0521 hypothetical protein [7] (data from MRSA252) SACOL0599 hypothetical protein [7] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [7] (data from MRSA252) SACOL0876 hypothetical protein [7] (data from MRSA252) SACOL0944 NADH dehydrogenase [7] (data from MRSA252) SACOL1593 glycine dehydrogenase subunit 2 [7] (data from MRSA252) SACOL1615 DEAD/DEAH box helicase [7] (data from MRSA252) SACOL1670 hypothetical protein [7] (data from MRSA252) SACOL1753 universal stress protein [7] (data from MRSA252) SACOL2173 alkaline shock protein 23 [7] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: adk < secY < rplO < rpmD < rpsE < rplR < rplF < rpsH < rpsN < rplE < rplX < rplN < rpsQ < rpmC < rplP < rpsC < rplV < rpsS < rplB < rplW < rplD < rplC < rpsJ
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 11.26 h [8]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 7.00 7.01 7.02 7.03 7.04 7.05 7.06 7.07 7.08 7.09 7.10 7.11 7.12 7.13 7.14 7.15 7.16 7.17 7.18 7.19 7.20 7.21 7.22 7.23 7.24 7.25 7.26 7.27 7.28 7.29 7.30 7.31 7.32 7.33 7.34 7.35 7.36 7.37 7.38 7.39 7.40 7.41 7.42 7.43 7.44 7.45 7.46 7.47 7.48 7.49 7.50 7.51 7.52 7.53 7.54 7.55 7.56 7.57 7.58 7.59 7.60 7.61 7.62 7.63 7.64 7.65 7.66 7.67 7.68 7.69 7.70 7.71 7.72 7.73 7.74 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]