From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003575000
  • symbol?: pnpA
  • description?: polynucleotide phosphorylase/polyadenylase

      descriptions from strain specific annotations:

    • polynucleotide phosphorylase/polyadenylase
    • polyribonucleotide nucleotidyltransferase
    • polynucleotide phosphorylase
    • Polynucleotide adenylyltransferase
    • polyribonucleotide nucleotidyltransferase (Polynucleotidephosphorylase) (PNPase) (Vegetative protein 15) (VEG15)
  • strand?: +
  • coordinates?: 3912399..3914495
  • synteny block?: BlockID0026520
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1293 (pnp)
    N315:
    SA1117 (pnpA)
    NCTC8325:
    Newman:
    NWMN_1183 (pnpA)
    USA300_FPR3757:
    04-02981:
    SA2981_1232 (pnpA)
    08BA02176:
    C248_1307 (pnpA)
    11819-97:
    MS7_1232 (pnp)
    71193:
    ST398NM01_1276
    ECT-R 2:
    ECTR2_1130
    ED133:
    SAOV_1276 (pnpA)
    ED98:
    SAAV_1249 (pnp)
    HO 5096 0412:
    SAEMRSA15_11070 (pnpA)
    JH1:
    SaurJH1_1360
    JH9:
    SaurJH9_1334
    JKD6008:
    SAA6008_01229 (pnpA)
    JKD6159:
    SAA6159_01129 (pnpA)
    LGA251:
    SARLGA251_11850 (pnpA)
    M013:
    M013TW_1214
    MRSA252:
    SAR1250 (pnpA)
    MSHR1132:
    SAMSHR1132_11170
    MSSA476:
    SAS1208
    Mu3:
    SAHV_1264 (pnpA)
    Mu50:
    SAV1274 (pnpA)
    MW2:
    MW1157 (pnpA)
    RF122:
    SAB1136 (pnpA)
    ST398:
    SAPIG1276
    T0131:
    SAT0131_01328 (hutU)
    TCH60:
    HMPREF0772_11955 (pnp)
    TW20:
    SATW20_12680 (pnpA)
    USA300_TCH1516:
    USA300HOU_1206 (pnp)
    VC40:
    SAVC_05535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
    N315            MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
    NCTC8325        MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
    Newman          MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
    USA300_FPR3757  MSQEKKVFKTEWAGRSLTIETGQLAKQANGAVLVRYGDTVVLSTATASKEPRDGDFFPLT
                    ************************************************************

    COL             VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
    N315            VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
    NCTC8325        VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
    Newman          VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
    USA300_FPR3757  VNYEEKMYAAGKIPGGFKKREGRPGDDATLTARLIDRPIRPLFPKGYKHDVQIMNMVLSA
                    ************************************************************

    COL             DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
    N315            DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
    NCTC8325        DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
    Newman          DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
    USA300_FPR3757  DPDCSPQMAAMIGSSMALSVSDIPFQGPIAGVNVGYIDGKYIINPTVEEKEVSRLDLEVA
                    ************************************************************

    COL             GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
    N315            GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
    NCTC8325        GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
    Newman          GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
    USA300_FPR3757  GHKDAVNMVEAGASEITEQEMLEAIFFGHEEIQRLVDFQQQIVDHIQPVKQEFIPAERDE
                    ************************************************************

    COL             ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
    N315            ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
    NCTC8325        ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
    Newman          ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
    USA300_FPR3757  ALVERVKSLTEEKGLKETVLTFDKQQRDENLDNLKEEIVNEFIDEEDPENELLIKEVYAI
                    ************************************************************

    COL             LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
    N315            LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
    NCTC8325        LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
    Newman          LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
    USA300_FPR3757  LNELVKEEVRRLIADEKIRPDGRKPDEIRPLDSEVGILPRTHGSGLFTRGQTQALSVLTL
                    ************************************************************

    COL             GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
    N315            GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
    NCTC8325        GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
    Newman          GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
    USA300_FPR3757  GALGDYQLIDGLGPEEEKRFMHHYNFPNFSVGETGPVRAPGRREIGHGALGERALKYIIP
                    ************************************************************

    COL             DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
    N315            DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
    NCTC8325        DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
    Newman          DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
    USA300_FPR3757  DTADFPYTIRIVSEVLESNGSSSQASICGSTLALMDAGVPIKAPVAGIAMGLVTREDSYT
                    ************************************************************

    COL             ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
    N315            ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
    NCTC8325        ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
    Newman          ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
    USA300_FPR3757  ILTDIQGMEDALGDMDFKVAGTKEGITAIQMDIKIDGLTREIIEEALEQARRGRLEIMNH
                    ************************************************************

    COL             MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
    N315            MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
    NCTC8325        MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
    Newman          MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
    USA300_FPR3757  MLQTIDQPRTELSAYAPKVVTMTIKPDKIRDVIGPGGKKINEIIDETGVKLDIEQDGTIF
                    ************************************************************

    COL             IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
    N315            IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
    NCTC8325        IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
    Newman          IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
    USA300_FPR3757  IGAVDQAMINRAREIIEEITREAEVGQTYQATVKRIEKYGAFVGLFPGKDALLHISQISK
                    ************************************************************

    COL             NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
    N315            NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
    NCTC8325        NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
    Newman          NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
    USA300_FPR3757  NRIEKVEDVLKIGDTIEVKITEIDKQGRVNASHRALEE
                    **************************************