From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003576000
  • symbol?: rnjB
  • description?: metallo-beta-lactamase family protein

      descriptions from strain specific annotations:

    • metallo-beta-lactamase family protein
    • beta-lactamase domain-containing protein
    • Zn-dependent hydrolase, RNA-metabolising, CPSF 100 kDa analog
    • ribonuclease J 2
    • RNA-metabolising metallo-beta-lactamase
    • Beta-lactamase domain protein
    • metallo-beta-lactamase superfamily protein
    • putative Zn-dependent hydrolase
  • strand?: +
  • coordinates?: 3914688..3916424
  • synteny block?: BlockID0026530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1233
    08BA02176:
    C248_1308
    11819-97:
    MS7_1233 (rnjB)
    71193:
    ST398NM01_1277
    ECT-R 2:
    ECTR2_1131
    ED133:
    SAOV_1277
    ED98:
    SAAV_1250
    HO 5096 0412:
    SAEMRSA15_11080
    JH1:
    SaurJH1_1361
    JH9:
    SaurJH9_1335
    JKD6008:
    SAA6008_01230
    JKD6159:
    SAA6159_01130
    LGA251:
    SARLGA251_11860
    M013:
    M013TW_1215
    MRSA252:
    SAR1251
    MSHR1132:
    SAMSHR1132_11180
    MSSA476:
    SAS1209
    Mu3:
    SAHV_1265
    Mu50:
    SAV1275
    MW2:
    MW1158
    RF122:
    SAB1137
    ST398:
    SAPIG1277
    T0131:
    SAT0131_01330
    TCH60:
    HMPREF0772_11954
    TW20:
    SATW20_12690
    USA300_TCH1516:
    USA300HOU_1207
    VC40:
    SAVC_05540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------------------------------MFMLDAGLM
    N315            -----------------MSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLM
    NCTC8325        ---------------------------------------------------MFMLDAGLM
    Newman          -----------------MSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLM
    USA300_FPR3757  MNSEFIYGRVTNLGGKILSLIKKKNKDIRIIPLGGVGEIAKNMYIVEVDDEMFMLDAGLM
                                                                       *********

    COL             FPEDEMLGIDIVIPDISYVLENKDKLKGIFLTHGHEHAIGAVSYVLEQLDAPVYGSKLTI
    N315            FPEDEMLGIDIVIPDISYVLENKDKLKGIFLTHGHEHAIGAVSYVLEQLDAPVYGSKLTI
    NCTC8325        FPEDEMLGIDIVIPDISYVLENKDKLKGIFLTHGHEHAIGAVSYVLEQLDAPVYGSKLTI
    Newman          FPEDEMLGIDIVIPDISYVLENKDKLKGIFLTHGHEHAIGAVSYVLEQLDAPVYGSKLTI
    USA300_FPR3757  FPEDEMLGIDIVIPDISYVLENKDKLKGIFLTHGHEHAIGAVSYVLEQLDAPVYGSKLTI
                    ************************************************************

    COL             ALIKENMKARNIDKKVRYYTVNNDSIMRFKNVNISFFNTTHSIPDSLGVCIHTSYGAIVY
    N315            ALIKENMKARNIDKKVRYYTVNNDSIMRFKNVNISFFNTTHSIPDSLGVCIHTSYGAIVY
    NCTC8325        ALIKENMKARNIDKKVRYYTVNNDSIMRFKNVNISFFNTTHSIPDSLGVCIHTSYGAIVY
    Newman          ALIKENMKARNIDKKVRYYTVNNDSIMRFKNVNISFFNTTHSIPDSLGVCIHTSYGAIVY
    USA300_FPR3757  ALIKENMKARNIDKKVRYYTVNNDSIMRFKNVNISFFNTTHSIPDSLGVCIHTSYGAIVY
                    ************************************************************

    COL             TGEFKFDQSLHGHYAPDIKRMAEIGEEGVFVLISDSTEAEKPGYNTPENVIEHHMYDAFA
    N315            TGEFKFDQSLHGHYAPDIKRMAEIGEEGVFVLISDSTEAEKPGYNTPENVIEHHMYDAFA
    NCTC8325        TGEFKFDQSLHGHYAPDIKRMAEIGEEGVFVLISDSTEAEKPGYNTPENVIEHHMYDAFA
    Newman          TGEFKFDQSLHGHYAPDIKRMAEIGEEGVFVLISDSTEAEKPGYNTPENVIEHHMYDAFA
    USA300_FPR3757  TGEFKFDQSLHGHYAPDIKRMAEIGEEGVFVLISDSTEAEKPGYNTPENVIEHHMYDAFA
                    ************************************************************

    COL             KVRGRLIVSCYASNFIRIQQVLNIASKLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLI
    N315            KVRGRLIVSCYASNFIRIQQVLNIASKLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLI
    NCTC8325        KVRGRLIVSCYASNFIRIQQVLNIASKLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLI
    Newman          KVRGRLIVSCYASNFIRIQQVLNIASKLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLI
    USA300_FPR3757  KVRGRLIVSCYASNFIRIQQVLNIASKLNRKVSFLGRSLESSFNIARKMGYFDIPKDLLI
                    ************************************************************

    COL             PITEVDNYPKNEVIIIATGMQGEPVEALSQMAQHKHKIMNIEEGDSVFLAITASANMEVI
    N315            PITEVDNYPKNEVIIIATGMQGEPVEALSQMAQHKHKIMNIEEGDSVFLAITASANMEVI
    NCTC8325        PITEVDNYPKNEVIIIATGMQGEPVEALSQMAQHKHKIMNIEEGDSVFLAITASANMEVI
    Newman          PITEVDNYPKNEVIIIATGMQGEPVEALSQMAQHKHKIMNIEEGDSVFLAITASANMEVI
    USA300_FPR3757  PITEVDNYPKNEVIIIATGMQGEPVEALSQMAQHKHKIMNIEEGDSVFLAITASANMEVI
                    ************************************************************

    COL             IANTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMINIMKPEYFIPVQGEFKMQIAHAK
    N315            IANTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMINIMKPEYFIPVQGEFKMQIAHAK
    NCTC8325        IANTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMINIMKPEYFIPVQGEFKMQIAHAK
    Newman          IANTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMINIMKPEYFIPVQGEFKMQIAHAK
    USA300_FPR3757  IANTLNELVRAGAHIIPNNKKIHASSHGCMEELKMMINIMKPEYFIPVQGEFKMQIAHAK
                    ************************************************************

    COL             LAAEAGVAPEKIFLVEKGDVINYNGKDMILNEKVNSGNILIDGIGIGDVGNIVLRDRHLL
    N315            LAAEAGVAPEKIFLVEKGDVINYNGKDMILNEKVNSGNILIDGIGIGDVGNIVLRDRHLL
    NCTC8325        LAAEAGVAPEKIFLVEKGDVINYNGKDMILNEKVNSGNILIDGIGIGDVGNIVLRDRHLL
    Newman          LAAEAGVAPEKIFLVEKGDVINYNGKDMILNEKVNSGNILIDGIGIGDVGNIVLRDRHLL
    USA300_FPR3757  LAAEAGVAPEKIFLVEKGDVINYNGKDMILNEKVNSGNILIDGIGIGDVGNIVLRDRHLL
                    ************************************************************

    COL             AEDGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEDLLREAEEKVREIVEAGLQEKRI
    N315            AEDGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEDLLREAEEKVREIVEAGLQEKRI
    NCTC8325        AEDGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEDLLREAEEKVREIVEAGLQEKRI
    Newman          AEDGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEDLLREAEEKVREIVEAGLQEKRI
    USA300_FPR3757  AEDGIFIAVVTLDPKNRRIAAGPEIQSRGFVYVRESEDLLREAEEKVREIVEAGLQEKRI
                    ************************************************************

    COL             EWSEIKQNMRDQISKLLFESTKRRPMIIPVISEI
    N315            EWSEIKQNMRDQISKLLFESTKRRPMIIPVISEI
    NCTC8325        EWSEIKQNMRDQISKLLFESTKRRPMIIPVISEI
    Newman          EWSEIKQNMRDQISKLLFESTKRRPMIIPVISEI
    USA300_FPR3757  EWSEIKQNMRDQISKLLFESTKRRPMIIPVISEI
                    **********************************