From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003578000
  • symbol?:
  • description?: GntR family transcriptional regulator

      descriptions from strain specific annotations:

    • GntR family transcriptional regulator
    • transcriptional regulator, GntR family protein
    • bacterial regulatory s, gntR family protein
    • pseudogene
    • regulatory proteins, gntR family protein
    • Transcriptional regulator in cluster with Zn-dependent hydrolase
    • transcription regulator GntR family
    • UbiC transcription regulator-associated domain-containing protein
    • UTRA domain transcriptional regulator
  • strand?: +
  • coordinates?: 3919057..3919650
  • synteny block?: BlockID0026550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1235
    08BA02176:
    C248_1310
    11819-97:
    MS7_1235
    71193:
    ST398NM01_1279
    ECT-R 2:
    ECTR2_1133
    ED133:
    SAOV_1279
    ED98:
    SAAV_1252
    HO 5096 0412:
    SAEMRSA15_11100
    JH1:
    SaurJH1_1363
    JH9:
    SaurJH9_1337
    JKD6008:
    SAA6008_01232
    JKD6159:
    SAA6159_01132
    LGA251:
    SARLGA251_11880
    M013:
    M013TW_1217
    MRSA252:
    SAR1253
    MSHR1132:
    SAMSHR1132_11200
    MSSA476:
    SAS1211
    Mu3:
    SAHV_1267
    Mu50:
    SAV1277
    MW2:
    MW1160
    RF122:
    SAB1139
    ST398:
    SAPIG1279
    T0131:
    SAT0131_01332 (hutG)
    TCH60:
    HMPREF0772_11952
    TW20:
    SATW20_12710
    USA300_TCH1516:
    USA300HOU_1209
    VC40:
    SAVC_05550

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSEMNAVYNVKQYILNLIKQNKLEYGDQLPSNLSIARELNVKTDDVYEAIQALITEQVIK
    N315            MSEMNAVYNVKQYILNLIMQNKLEYGDQLPSNLSIARELNVKTDDVYEAIQALITEQVIK
    NCTC8325        MSEMNAVYNVKQYILNLIKQNKLEYGDQLPSNLSIARELNVKTDDVYEAIQALITEQVIK
    Newman          MSEMNAVYNVKQYILNLIKQNKLEYGDQLPSNLSIARELNVKTDDVYEAIQALITEQVIK
    USA300_FPR3757  MSEMNAVYNVKQYILNLIKQNKLEYGDQLPSNLSIARELNVKTDDVYEAIQALITEQVIK
                    ****************** *****************************************

    COL             DNFEEGTSVKSLPPFFYPLNELISIGQMIKNAGFECGTEYLNFDEQPATMLDANLLSVEE
    N315            DNFEEGTSVKSLPPFFYPLNELISIGQMIKNAGFECGTEYLNFDEQPATMLDANLLSVEE
    NCTC8325        DNFEEGTSVKSLPPFFYPLNELISIGQMIKNAGFECGTEYLNFDEQPATMLDANLLSVEE
    Newman          DNFEEGTSVKSLPPFFYPLNELISIGQMIKNAGFECGTEYLNFDEQPATMLDANLLSVEE
    USA300_FPR3757  DNFEEGTSVKSLPPFFYPLNELISIGQMIKNAGFECGTEYLNFDEQPATMLDANLLSVEE
                    ************************************************************

    COL             GYPVTIIERLRTADGEPVVYCLDKIAKKELTCTEYQMSNGSILSAIKEQSNHNICYADTE
    N315            GYPVTIIERLRTADGEPVVYCLDKIAKKELTCTEYQMSNGSILSAIKEQSNHNICYADTE
    NCTC8325        GYPVTIIERLRTADGEPVVYCLDKIAKKELTCTEYQMSNGSILSAIKEQSNHNICYADTE
    Newman          GYPVTIIERLRTADGEPVVYCLDKIAKKELTCTEYQMSNGSILSAIKEQSNHNICYADTE
    USA300_FPR3757  GYPVTIIERLRTADGEPVVYCLDKIAKKELTCTEYQMSNGSILSAIKEQSNHNICYADTE
                    ************************************************************

    COL             IEAVNYEPRISEVLNASPHEGLILLKITHYNESDEPILYSLNYMKNSLVQFKITRKI
    N315            IEAVNYEPRISEVLNASPHEGLILLKITHYNELDEPILYSLNYMKNSLVQFKITRKI
    NCTC8325        IEAVNYEPRISEVLNASPHEGLILLKITHYNESDEPILYSLNYMKNSLVQFKITRKI
    Newman          IEAVNYEPRISEVLNASPHEGLILLKITHYNESDEPILYSLNYMKNSLVQFKITRKI
    USA300_FPR3757  IEAVNYEPRISEVLNASPHEGLILLKITHYNESDEPILYSLNYMKNSLVQFKITRKI
                    ******************************** ************************