From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003582000
  • symbol?:
  • description?: 3-oxoacyl-ACP reductase

      descriptions from strain specific annotations:

    • 3-oxoacyl-ACP reductase
    • acetoacetyl-CoA reductase
    • putative acetoacetyl-CoA reductase
    • 3-ketoacyl-
    • 3-oxoacyl-[acyl-carrier protein] reductase
    • acetoacetyl-CoA reductase, putative
    • pseudogene
    • putative 3-oxoacyl-acyl carrier protein reductase
    • putative short chain dehydrogenase
    • short-chain dehydrogenase/reductase SDR
    • short chain dehydrogenase family protein
  • strand?: +
  • coordinates?: 3922370..3923075
  • synteny block?: BlockID0026590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1238
    08BA02176:
    C248_1313
    11819-97:
    MS7_1238
    71193:
    ST398NM01_1282
    ECT-R 2:
    ECTR2_1136
    ED133:
    SAOV_1282
    ED98:
    SAAV_1255
    HO 5096 0412:
    SAEMRSA15_11130
    JH1:
    SaurJH1_1366
    JH9:
    SaurJH9_1340
    JKD6008:
    SAA6008_01235
    JKD6159:
    SAA6159_01135
    LGA251:
    SARLGA251_11910
    M013:
    M013TW_1222
    MRSA252:
    SAR1256
    MSHR1132:
    SAMSHR1132_11230
    MSSA476:
    SAS1214
    Mu3:
    SAHV_1270
    Mu50:
    SAV1280
    MW2:
    MW1163
    RF122:
    SAB1142
    ST398:
    SAPIG1282
    T0131:
    SAT0131_01336
    TCH60:
    HMPREF0772_11948 (phbB)
    TW20:
    SATW20_12740
    USA300_TCH1516:
    USA300HOU_1212
    VC40:
    SAVC_05565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTID
    N315            MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTID
    NCTC8325        MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTID
    Newman          MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTID
    USA300_FPR3757  MKALVLGGSGSIGSEIVKQLLTDGFEVYVQYYRTDINELTSKFNDDKVRFIQADLSQTID
                    ************************************************************

    COL             IDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSA
    N315            IDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSA
    NCTC8325        IDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSA
    Newman          IDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSA
    USA300_FPR3757  IDKTFGDIKSLDCLIYASGQSLYGVLQDMKDHDIDACYQLNVLQLIRLCRYFVDVLRQSA
                    ************************************************************

    COL             NGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMA
    N315            NGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMA
    NCTC8325        NGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMA
    Newman          NGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMA
    USA300_FPR3757  NGRIIVISSIWGETGASMETIYSAMKSAQLGFVKALSQELALTSVTVNAIAPGFVAGNMA
                    ************************************************************

    COL             SEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHPNARSVTGTIQKVNGAWYI
    N315            SEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHSNARSVTGTIQKVNGAWYI
    NCTC8325        SEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHPNARSVTGTIQKVNGAWYI
    Newman          SEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHPNARSVTGTIQKVNGAWYI
    USA300_FPR3757  SEWQEDELQAMITELPQQRLVLPSEVAHTCAYLYHPNARSVTGTIQKVNGAWYI
                    ***********************************.******************