From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003587000
  • symbol?: recA
  • description?: recombinase A

      descriptions from strain specific annotations:

    • recombinase A
    • RecA protein
    • protein RecA
    • recombination protein RecA
    • Reca
    • recombination protein A
  • strand?: +
  • coordinates?: 3927370..3928413
  • synteny block?: BlockID0026640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1304 (recA)
    N315:
    SA1128 (recA)
    NCTC8325:
    Newman:
    NWMN_1194 (recA)
    USA300_FPR3757:
    04-02981:
    SA2981_1243 (recA)
    08BA02176:
    C248_1318 (recA)
    11819-97:
    MS7_1243 (recA)
    71193:
    ST398NM01_1287
    ECT-R 2:
    ECTR2_1141 (recA)
    ED133:
    SAOV_1287 (recA)
    ED98:
    SAAV_1260 (recA)
    HO 5096 0412:
    SAEMRSA15_11180 (recA)
    JH1:
    SaurJH1_1371 (recA)
    JH9:
    SaurJH9_1345 (recA)
    JKD6008:
    SAA6008_01240 (recA)
    JKD6159:
    SAA6159_01140 (recA)
    LGA251:
    SARLGA251_11960 (recA)
    M013:
    M013TW_1227
    MRSA252:
    SAR1261 (recA)
    MSHR1132:
    SAMSHR1132_11280
    MSSA476:
    SAS1219 (recA)
    Mu3:
    SAHV_1275 (recA)
    Mu50:
    SAV1285 (recA)
    MW2:
    MW1168 (recA)
    RF122:
    SAB1147 (recA)
    ST398:
    SAPIG1287 (recA)
    T0131:
    SAT0131_01341
    TCH60:
    HMPREF0772_11943 (recA)
    TW20:
    SATW20_12790 (recA)
    USA300_TCH1516:
    USA300HOU_1217 (recA)
    VC40:
    SAVC_05590 (recA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDNDRQKALDTVIKNMEKSFGKGAVMKLGDNIGRRVSTTSTGSVTLDNALGVGGYPKGRI
    N315            MDNDRQKALDTVIKNMEKSFGKGAVMKLGDNIGRRVSTTSTGSVTLDNALGVGGYPKGRI
    NCTC8325        MDNDRQKALDTVIKNMEKSFGKGAVMKLGDNIGRRVSTTSTGSVTLDNALGVGGYPKGRI
    Newman          MDNDRQKALDTVIKNMEKSFGKGAVMKLGDNIGRRVSTTSTGSVTLDNALGVGGYPKGRI
    USA300_FPR3757  MDNDRQKALDTVIKNMEKSFGKGAVMKLGDNIGRRVSTTSTGSVTLDNALGVGGYPKGRI
                    ************************************************************

    COL             IEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPDH
    N315            IEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPDH
    NCTC8325        IEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPDH
    Newman          IEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPDH
    USA300_FPR3757  IEIYGPESSGKTTVALHAIAEVQSNGGVAAFIDAEHALDPEYAQALGVDIDNLYLSQPDH
                    ************************************************************

    COL             GEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLSGA
    N315            GEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLSGA
    NCTC8325        GEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLSGA
    Newman          GEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLSGA
    USA300_FPR3757  GEQGLEIAEAFVRSGAVDIVVVDSVAALTPKAEIEGEMGDTHVGLQARLMSQALRKLSGA
                    ************************************************************

    COL             ISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNR
    N315            ISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNR
    NCTC8325        ISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNR
    Newman          ISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNR
    USA300_FPR3757  ISKSNTTAIFINQIREKVGVMFGNPETTPGGRALKFYSSVRLEVRRAEQLKQGQEIVGNR
                    ************************************************************

    COL             TKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQG
    N315            TKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQG
    NCTC8325        TKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQG
    Newman          TKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQG
    USA300_FPR3757  TKIKVVKNKVAPPFRVAEVDIMYGQGISKEGELIDLGVENDIVDKSGAWYSYNGERMGQG
                    ************************************************************

    COL             KENVKMYLKENPQIKEEIDRKLREKLGISDGDVEETEDAPKSLFDEE
    N315            KENVKMYLKENPQIKEEIDRKLREKLGISDGDVEETEDAPKSLFDEE
    NCTC8325        KENVKMYLKENPQIKEEIDRKLREKLGISDGDVEETEDAPKSLFDEE
    Newman          KENVKMYLKENPQIKEEIDRKLREKLGISDGDVEETEDAPKSLFDEE
    USA300_FPR3757  KENVKMYLKENPQIKEEIDRKLREKLGISDGDVEETEDAPKSLFDEE
                    ***********************************************